DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43218 and CG5883

Sequence 1:NP_001246864.1 Gene:CG43218 FlyBaseID:FBgn0262854 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster

Alignment Length:194 Identity:44/195 (23%)
Similarity:63/195 (32%) Gaps:58/195 (30%)


  Fly    14 LSDYFTS-GQSYTYNADEIC-----ICSGHLVNDLVPDCEDCSGYYICGDGSYEKVKCPQGLIFD 72
            |..||.. .:|..|:.|.:|     ||....|.....|..:|..||.|...|..:..|..||.::
  Fly   128 LGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDANCHKYYTCSSKSLVENTCENGLYYN 192

  Fly    73 IALNTCVLGQCPRFDGTCSANSTVPPPVTTTTTTAAPETIPPTPSGPCDNDVTCQLQEKSIPHPT 137
            :|..|||    .:.|..|..:                    |.|...|.|. ...::.|.:....
  Fly   193 VATGTCV----RKKDVICENH--------------------PLPDEVCGNK-KLAVRNKFVSDMA 232

  Fly   138 HCRNFYTCYGKCAVLG-----------LCELGKWFD--------REGNVCNYSHKVTNCPANQD 182
            .||.:|.|..    ||           .|:...:|:        ||...|:|.    .|...:|
  Fly   233 TCRGYYYCRD----LGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKCDYD----RCDGRKD 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43218NP_001246864.1 CBM_14 34..79 CDD:279884 14/45 (31%)
CBM_14 133..177 CDD:279884 12/63 (19%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 6/18 (33%)
CBM_14 154..204 CDD:279884 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.