DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43218 and obst-E

Sequence 1:NP_001246864.1 Gene:CG43218 FlyBaseID:FBgn0262854 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster

Alignment Length:139 Identity:33/140 (24%)
Similarity:55/140 (39%) Gaps:19/140 (14%)


  Fly    45 DCEDCSGYYICGDGSYEKVKCPQGLIFDIALNTCVLGQCPRFDGTCSANSTV--PPPVTTTTTTA 107
            |...|..|..|..|.....|||:||.|:.....|   ..|....:|:|.:.:  ..|...:...:
  Fly   104 DATKCGVYRNCAHGVASLTKCPEGLAFNEETYQC---DWPDLVESCNAEAYLGFNCPAADSADDS 165

  Fly   108 APETIPPTPSGPCDNDVTCQLQEKSIPHPTHCRNFYTCYGKCAVLGLCELGKW--FDREGNVCNY 170
            |...:..:|.|          :.:...||..|:.::.|......|..|  ||:  |:.:..:|::
  Fly   166 AAAAVDVSPEG----------ELRYYRHPQTCKKYFVCVNGHPRLYNC--GKYLAFNSQTKLCDF 218

  Fly   171 SHKVTNCPA 179
            .:||..|.|
  Fly   219 YNKVPECYA 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43218NP_001246864.1 CBM_14 34..79 CDD:279884 12/34 (35%)
CBM_14 133..177 CDD:279884 12/46 (26%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696
CBM_14 95..146 CDD:307643 13/45 (29%)
CBM_14 180..225 CDD:307643 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.