DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43336 and CG9377

DIOPT Version :10

Sequence 1:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:248 Identity:68/248 - (27%)
Similarity:115/248 - (46%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWMAFLHSTDGRFICGGSLITNRLVLTAAHCF----LDRTELVARLGEYDR--EEYEMCHDSYCT 108
            ||:..::.:| .::|.|:|||...|:|.|||.    :::..|:|  ||:|.  |.....|.....
  Fly   113 PWLVAVYGSD-TYLCSGALITPLAVITTAHCVQNSEMEKVRLLA--GEWDAAVELEPQPHQQRSV 174

  Fly   109 YRIEAMVERGFRHRHYNPMTMAYDIAILRLYRK--VQYTDNIRPICIVIDPR-----WRKYIDSL 166
              :|.:|     |.:|..|.:|::||||.:.::  .|...|::|||:. .||     .:.|:   
  Fly   175 --VETLV-----HPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLP-PPRIMYNYSQCYV--- 228

  Fly   167 DPLTGTGWGKTESEGDSAKL-RTVDLARKHPEVCRRYATLSLTANQ-------FCAGNERSNLCN 223
                 :||.:::. |.:|.| :...|....|:.||....|||...:       .|||.::.:...
  Fly   229 -----SGWQRSDF-GRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC 287

  Fly   224 GD-SGGPVGALIPY-GKSKRFVQVGIASFTNTQC---VMVSVFTDVMSYVDWI 271
            || ....|..:.|. |...||...|:.:.| .:|   .::.::|:|..|..||
  Fly   288 GDVDMTAVPLMCPLSGHDDRFHLAGLLTRT-ARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 66/246 (27%)
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 66/246 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.