DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and ECM14

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_012000.1 Gene:ECM14 / 856533 SGDID:S000001174 Length:430 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:26/99 - (26%)
Similarity:40/99 - (40%) Gaps:24/99 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVVHIMVS 71
            :||.:|.....|.:     .|..|:||: |........|.|.:...||:|::|.|..|.:.|.: 
Yeast    14 VLLAVTGAVQGLQE-----DYSEYAVYR-FTSDNYSTLVRDVIAPLTDDYDVWTRSNNFIDIKL- 71

  Fly    72 PVE-----KDSFLAVMQKENIVVEVLIKNVQTLI 100
            |.|     .|.            :|:|.|:..||
Yeast    72 PKEIGEQINDG------------QVIIDNMNELI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 19/73 (26%)
ECM14NP_012000.1 M14_CP_A-B_like 121..425 CDD:349433
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.