powered by:
Protein Alignment CG43235 and ECM14
DIOPT Version :9
| Sequence 1: | NP_001245931.1 |
Gene: | CG43235 / 12798301 |
FlyBaseID: | FBgn0262880 |
Length: | 103 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_012000.1 |
Gene: | ECM14 / 856533 |
SGDID: | S000001174 |
Length: | 430 |
Species: | Saccharomyces cerevisiae |
| Alignment Length: | 99 |
Identity: | 26/99 - (26%) |
| Similarity: | 40/99 - (40%) |
Gaps: | 24/99 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 MLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVVHIMVS 71
:||.:|.....|.: .|..|:||: |........|.|.:...||:|::|.|..|.:.|.:
Yeast 14 VLLAVTGAVQGLQE-----DYSEYAVYR-FTSDNYSTLVRDVIAPLTDDYDVWTRSNNFIDIKL- 71
Fly 72 PVE-----KDSFLAVMQKENIVVEVLIKNVQTLI 100
|.| .|. :|:|.|:..||
Yeast 72 PKEIGEQINDG------------QVIIDNMNELI 93
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG43235 | NP_001245931.1 |
Propep_M14 |
34..102 |
CDD:280416 |
18/72 (25%) |
| ECM14 | NP_012000.1 |
M14_CP_A-B_like |
121..425 |
CDD:349433 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000056 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.