DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43235 and cpa1

Sequence 1:NP_001245931.1 Gene:CG43235 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001107681.1 Gene:cpa1 XenbaseID:XB-GENE-960032 Length:420 Species:Xenopus tropicalis

Alignment Length:110 Identity:27/111 (24%)
Similarity:48/111 (43%) Gaps:21/111 (19%)


  Fly     1 MRPQIAMLLLITAWKSSLSDPIGPRSYENYS---VYKVFIKTRSDQQVIDGLLKDTDNY---NLW 59
            |:..:|:|.|:.| .|||         ||:|   |.::|....:...::..|  :.:.|   :.|
 Frog     1 MKGILALLALVVA-ASSL---------ENFSGQQVLRIFPSDEAQVNLVRAL--EDEEYLQLDFW 53

  Fly    60 ---HRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101
               .|.|..:.|.|......|....::..:|...::|.:||.|:|
 Frog    54 TSPSRVLLPIDIRVPLHHLQSVKVYLESNSIQYSIMIHDVQNLLD 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 15/75 (20%)
cpa1NP_001107681.1 Propep_M14 27..99 CDD:280416 15/75 (20%)
MpaA 28..402 CDD:225421 15/74 (20%)
M14_CPA 119..418 CDD:133081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.