DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43235 and cpb1

Sequence 1:NP_001245931.1 Gene:CG43235 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_012818773.1 Gene:cpb1 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis

Alignment Length:107 Identity:21/108 (19%)
Similarity:48/108 (44%) Gaps:18/108 (17%)


  Fly     6 AMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNVVHIMV 70
            |:|||::....|..    ||::....|::|..:.....::|..:.: |:..:.|   |.....:|
 Frog     3 ALLLLVSLAAVSAE----PRNFHGEKVFRVIPQNAEHVELIKSMAQ-TEGLDFW---LPDSAQLV 59

  Fly    71 SPVEKDSF----------LAVMQKENIVVEVLIKNVQTLIDR 102
            ...::..|          .|::|:..:..|:||.::|..:::
 Frog    60 EQGKRADFHADGHVSYEVQALLQQSGMPYEILINDLQDALEK 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 13/78 (17%)
cpb1XP_012818773.1 Propep_M14 27..101 CDD:280416 13/78 (17%)
Peptidase_M14_like 111..410 CDD:299699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.