DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43235 and CG2915

Sequence 1:NP_001245931.1 Gene:CG43235 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_610338.1 Gene:CG2915 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster

Alignment Length:86 Identity:18/87 (21%)
Similarity:35/87 (40%) Gaps:3/87 (3%)


  Fly    20 DPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNV---VHIMVSPVEKDSFLAV 81
            :|.....|:||.:|.|..:.:...::...|.:.:|:.........|   :.|:|:.........:
  Fly    48 NPPDQARYDNYRIYNVEFENQEQIELFQKLEEQSDSLTFIGHAREVGQKLSILVAAHRVADIADL 112

  Fly    82 MQKENIVVEVLIKNVQTLIDR 102
            ::...:...||..|.|..|||
  Fly   113 LKTYKVKHRVLTYNFQEKIDR 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 12/71 (17%)
CG2915NP_610338.1 MpaA 50..433 CDD:225421 17/85 (20%)
Propep_M14 63..133 CDD:280416 12/70 (17%)
M14_CP_A-B_like 153..446 CDD:199844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.