powered by:
Protein Alignment CG43235 and Cpa6
DIOPT Version :9
| Sequence 1: | NP_001245931.1 |
Gene: | CG43235 / 12798301 |
FlyBaseID: | FBgn0262880 |
Length: | 103 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_038965675.1 |
Gene: | Cpa6 / 312913 |
RGDID: | 1311764 |
Length: | 290 |
Species: | Rattus norvegicus |
| Alignment Length: | 46 |
Identity: | 13/46 - (28%) |
| Similarity: | 24/46 - (52%) |
Gaps: | 9/46 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 LKDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKN 95
|:||..: |..:..:::.|...::.||| :||.:. |:||
Rat 252 LRDTGYF-----GFLLPEMLIKPTCTETMLAV---KNITMH-LLKN 288
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2866 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000056 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.