DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and Cpa6

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001402791.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:438 Species:Rattus norvegicus


Alignment Length:88 Identity:21/88 - (23%)
Similarity:45/88 - (51%) Gaps:14/88 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SYEN-YSVYKVF-IKTRSDQQVIDGLLKDTDN---YNLWHRGL-------NVVHIMVSPVEKDSF 78
            ||:| |:.:||. :..:|:::.:  .||...:   .:||....       .:..:.|:.....:.
  Rat    32 SYDNRYAGHKVIRLIPKSEEEAL--ALKSVSHQLKVDLWQPSSISYVSEGTITDVRVTQNASRTL 94

  Fly    79 LAVMQKENIVVEVLIKNVQTLID 101
            ||::|:.||..:|||:::|..::
  Rat    95 LAILQETNIQYKVLIEDLQKAVE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 17/80 (21%)
Cpa6NP_001402791.1 Propep_M14 43..119 CDD:460505 15/77 (19%)
Peptidase_M14_like 138..437 CDD:472171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.