DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and cpa5

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_954965.1 Gene:cpa5 / 246092 ZFINID:ZDB-GENE-020514-1 Length:419 Species:Danio rerio


Alignment Length:114 Identity:28/114 - (24%)
Similarity:51/114 - (44%) Gaps:28/114 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRPQIAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGLNV 65
            |:..:.::.|..|       ..|.:::|...|:::   |..|:..||.|.:.|:...  |.||:|
Zfish     1 MKRLLVLIALFVA-------VFGKKTFEGDQVFRI---TPKDEAQIDLLKELTEEGE--HLGLSV 53

  Fly    66 ------------VHIMVSPVEK-DSFLAVMQKENIVVEVLIKNVQTLID 101
                        :|:....::. .:|||..|   |...::|:|||.|:|
Zfish    54 WMEPILESLPLDLHVPFHSLQAVRAFLAYNQ---IPYHIMIENVQELLD 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 22/82 (27%)
cpa5NP_954965.1 Propep_M14 26..101 CDD:460505 22/82 (27%)
M14_CPA 118..417 CDD:349442
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.