DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and ZC434.9

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001251356.1 Gene:ZC434.9 / 172908 WormBaseID:WBGene00013895 Length:720 Species:Caenorhabditis elegans


Alignment Length:108 Identity:25/108 - (23%)
Similarity:50/108 - (46%) Gaps:16/108 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RPQIAMLLLITAW--KSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGL--LKDTDNYNL--WH 60
            |..:.:|:||:|:  .:.::|...|:       ::|.....:|...:..|  :.:...::|  |.
 Worm     7 RNTLWLLILISAFAINAEIADDKPPK-------FQVLRAHATDVPQLKALRDIHERTQHDLDFWQ 64

  Fly    61 RGLNVVH---IMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI 100
            ....|.|   |||.....:...:|::..||..:|:|::|..||
 Worm    65 TPSKVGHRADIMVDEDRMEWLDSVLKNSNISYDVIIEDVGKLI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 18/75 (24%)
ZC434.9NP_001251356.1 Propep_M14 36..111 CDD:460505 17/72 (24%)
M14_CP_A-B_like 141..454 CDD:349433
ShK 682..719 CDD:426319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.