DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43235 and T06A4.1

DIOPT Version :10

Sequence 1:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_871809.1 Gene:T06A4.1 / 171669 WormBaseID:WBGene00020281 Length:606 Species:Caenorhabditis elegans


Alignment Length:80 Identity:16/80 - (20%)
Similarity:36/80 - (45%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YENYSVYKVFIKTRSDQQVIDGLLKDTDNYNL--WHRGLN---VVHIMVSPVEKDSFLAVMQKEN 86
            |.|:.:.::..:|....:.:..|.:|...|.|  |....|   :|.:.|:|.:...|:..::.:.
 Worm    29 YHNFKLIRINPETEGSVKYLRSLYEDPSPYELDFWQPPTNIGAIVDLTVAPADAPRFVKDLESKK 93

  Fly    87 IVVEVLIKNVQTLID 101
            |...|.:.::...|:
 Worm    94 ISYIVAVNDLSKAIE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 14/74 (19%)
T06A4.1NP_871809.1 Propep_M14 35..110 CDD:460505 14/74 (19%)
M14_CP_A-B_like 128..435 CDD:349433
ShK 568..602 CDD:426319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.