DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43235 and CPB1

Sequence 1:NP_001245931.1 Gene:CG43235 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001862.2 Gene:CPB1 HGNCID:2299 Length:417 Species:Homo sapiens

Alignment Length:104 Identity:20/105 (19%)
Similarity:47/105 (45%) Gaps:10/105 (10%)


  Fly     5 IAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWH-------RG 62
            :|:|:|:|...:|...  |...:|...|::|.::..:...:|.. |..|...:.|.       :.
Human     2 LALLVLVTVALASAHH--GGEHFEGEKVFRVNVEDENHINIIRE-LASTTQIDFWKPDSVTQIKP 63

  Fly    63 LNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLID 101
            .:.|...|...:..:...|:::..:..:|||.|::.:::
Human    64 HSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVE 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 12/76 (16%)
CPB1NP_001862.2 Propep_M14 29..103 CDD:280416 12/76 (16%)
M14_CPB 114..413 CDD:199852
Substrate binding. {ECO:0000250|UniProtKB:P00730} 176..179
Substrate binding. {ECO:0000250|UniProtKB:P00730} 251..252
Substrate binding. {ECO:0000250|UniProtKB:P00730} 305..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.