DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43319 and hspbap1

DIOPT Version :10

Sequence 1:NP_001247340.1 Gene:CG43319 / 12798278 FlyBaseID:FBgn0263024 Length:57 Species:Drosophila melanogaster
Sequence 2:XP_005167885.1 Gene:hspbap1 / 445320 ZFINID:ZDB-GENE-040808-38 Length:456 Species:Danio rerio


Alignment Length:44 Identity:12/44 - (27%)
Similarity:21/44 - (47%) Gaps:4/44 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IFAIVASGQKGKWKGYKDEEMGKSSYWKKVGNAESIVGNEINSI 56
            :|.|  .|:| :|..:..::.. ..|..:|...||.|.:.:|.|
Zfish   169 VFQI--QGRK-RWHLFPPDDTA-CLYPTRVPYEESSVFSHVNVI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43319NP_001247340.1 None
hspbap1XP_005167885.1 Cupin_8 15..264 CDD:463936 12/44 (27%)

Return to query results.
Submit another query.