DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and cbx5

DIOPT Version :8

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_988907.2 Gene:cbx5 / 394502 XenbaseID:XB-GENE-972727 Length:200 Species:Xenopus tropicalis

Alignment Length:66 Identity:28/66 - (42%)
Similarity:38/66 - (57%) Gaps:3/66 - (4%)


  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHLS--LPPPE 68
            |.||...|||:.. |.:....|||:|:|||...::|...|||.:.||:||.||.:.|:  ..|.|
 Frog   126 FERGLEPEKIIGA-TDSCGELMFLMKWKDSDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEE 189

  Fly    69 S 69
            |
 Frog   190 S 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 Chromo_shadow 12..63 CDD:279701 21/50 (42%)
cbx5NP_988907.2 Chromo 38..86 CDD:278797
Chromo_shadow 131..182 CDD:279701 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000276
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.