DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and Cbx5

DIOPT Version :8

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001100267.1 Gene:Cbx5 / 300266 RGDID:1306619 Length:191 Species:Rattus norvegicus

Alignment Length:75 Identity:29/75 - (38%)
Similarity:42/75 - (56%) Gaps:3/75 - (4%)


  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHLSLPP-PES 69
            |.||...|||:.. |.:..:.|||:|:||:...::|...|||.:.||:||.||.:.|:... ||.
  Rat   117 FERGLEPEKIIGA-TDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPED 180

  Fly    70 RKGNPRKRKA 79
            .: |..|..|
  Rat   181 AE-NKEKESA 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 Chromo_shadow 12..63 CDD:279701 20/50 (40%)
Cbx5NP_001100267.1 CD_HP1alpha_Cbx5 19..68 CDD:349298
CSD_HP1alpha_Cbx5 116..173 CDD:349302 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000276
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.