DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and Cbx3

DIOPT Version :10

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:68 Identity:27/68 - (39%)
Similarity:40/68 - (58%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHL---SLPPP 67
            |.||...|:|:.. |.::...|||:|:|||...::|...|||.:.||:||.||.:.|   |.|..
  Rat   117 FARGLDPERIIGA-TDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED 180

  Fly    68 ESR 70
            |::
  Rat   181 EAQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 CSD 10..62 CDD:349275 20/51 (39%)
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299
CSD_HP1gamma_Cbx3 116..173 CDD:349303 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.