DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and Cbx3

DIOPT Version :9

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:68 Identity:27/68 - (39%)
Similarity:40/68 - (58%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHL---SLPPP 67
            |.||...|:|:.. |.::...|||:|:|||...::|...|||.:.||:||.||.:.|   |.|..
  Rat   117 FARGLDPERIIGA-TDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED 180

  Fly    68 ESR 70
            |::
  Rat   181 EAQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 Chromo_shadow 12..63 CDD:279701 21/53 (40%)
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299
CSD_HP1gamma_Cbx3 116..173 CDD:349303 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.