DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43090 and Sfp38D

DIOPT Version :9

Sequence 1:NP_001245546.1 Gene:CG43090 / 12798122 FlyBaseID:FBgn0262536 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001163023.1 Gene:Sfp38D / 8673971 FlyBaseID:FBgn0261058 Length:169 Species:Drosophila melanogaster


Alignment Length:145 Identity:42/145 - (28%)
Similarity:67/145 - (46%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IAEIDAEVTKKLKSFLENFTGYWKDNTEFLNWIAKIRLALNNNSTDLAYKFELRYGFESYNKERL 86
            |.:::.|.|.:||..:|.:......|.||..||.|  |...:.|..|..|.:::..|::|::.||
  Fly    20 IGQLNDEATIRLKGLVEKYKLQALSNPEFSQWIGK--LEKTSKSRRLEDKMKVKAEFKNYDERRL 82

  Fly    87 VLEQQILDRVEDLDSIIPH------QKHAKCLNFYVDQRNALKTALKQSNSKKIERFAENSPSCP 145
            .||.:|.:|:..:|.:|..      .|...||.:|..|:.:||.|...||..|......||..|.
  Fly    83 QLENKIRERITAIDDLISDIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCE 147

  Fly   146 YYYFDANEFRNNLTN 160
            .....::|...:..|
  Fly   148 TTKVQSSELSESSEN 162



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008555
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.