DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43090 and Sfp38D

DIOPT Version :10

Sequence 1:NP_001245546.1 Gene:CG43090 / 12798122 FlyBaseID:FBgn0262536 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001163023.1 Gene:Sfp38D / 8673971 FlyBaseID:FBgn0261058 Length:169 Species:Drosophila melanogaster


Alignment Length:145 Identity:42/145 - (28%)
Similarity:67/145 - (46%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IAEIDAEVTKKLKSFLENFTGYWKDNTEFLNWIAKIRLALNNNSTDLAYKFELRYGFESYNKERL 86
            |.:::.|.|.:||..:|.:......|.||..||.|  |...:.|..|..|.:::..|::|::.||
  Fly    20 IGQLNDEATIRLKGLVEKYKLQALSNPEFSQWIGK--LEKTSKSRRLEDKMKVKAEFKNYDERRL 82

  Fly    87 VLEQQILDRVEDLDSIIPH------QKHAKCLNFYVDQRNALKTALKQSNSKKIERFAENSPSCP 145
            .||.:|.:|:..:|.:|..      .|...||.:|..|:.:||.|...||..|......||..|.
  Fly    83 QLENKIRERITAIDDLISDIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCE 147

  Fly   146 YYYFDANEFRNNLTN 160
            .....::|...:..|
  Fly   148 TTKVQSSELSESSEN 162

Return to query results.
Submit another query.