DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43090 and CG31680

DIOPT Version :9

Sequence 1:NP_001245546.1 Gene:CG43090 / 12798122 FlyBaseID:FBgn0262536 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_724273.1 Gene:CG31680 / 318881 FlyBaseID:FBgn0051680 Length:147 Species:Drosophila melanogaster


Alignment Length:152 Identity:46/152 - (30%)
Similarity:68/152 - (44%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLVTAQGPSEEIAEIDAEVTKKLKSFLENFTGYWKDNTEFLNWIAKIRLALNNNSTDLAYKFEL 74
            ||.|.    ||.:||:|...|.:|.:....:......|.||..||.::....:.           
  Fly    12 LGFVL----SESLAEMDRLATWRLHNISNKYKYLSTGNPEFYQWIERVNTVADE----------- 61

  Fly    75 RYGFESYNKERLVLEQQILDRVEDLDSIIPHQKHAK-CLNFYVDQRNALKTALKQSNSKKIERFA 138
               |..|||.|..||.||.:|:..:.|||..:..:| ||.||::|...|::|.|.||.:|.:...
  Fly    62 ---FNHYNKHRQRLEDQITERLITIRSIIAIRNASKRCLRFYLNQEAELESAYKSSNERKQQVLY 123

  Fly   139 ENSPSCPY----------YYFD 150
            :||..||:          |:.|
  Fly   124 QNSVRCPHGLDDGRLGDPYFVD 145



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008555
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.