Sequence 1: | NP_001245546.1 | Gene: | CG43090 / 12798122 | FlyBaseID: | FBgn0262536 | Length: | 169 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_724273.1 | Gene: | CG31680 / 318881 | FlyBaseID: | FBgn0051680 | Length: | 147 | Species: | Drosophila melanogaster |
Alignment Length: | 152 | Identity: | 46/152 - (30%) |
---|---|---|---|
Similarity: | 68/152 - (44%) | Gaps: | 29/152 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 LGLVTAQGPSEEIAEIDAEVTKKLKSFLENFTGYWKDNTEFLNWIAKIRLALNNNSTDLAYKFEL 74
Fly 75 RYGFESYNKERLVLEQQILDRVEDLDSIIPHQKHAK-CLNFYVDQRNALKTALKQSNSKKIERFA 138
Fly 139 ENSPSCPY----------YYFD 150 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45449849 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0008555 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |