| Sequence 1: | NP_001245546.1 | Gene: | CG43090 / 12798122 | FlyBaseID: | FBgn0262536 | Length: | 169 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_724273.1 | Gene: | CG31680 / 318881 | FlyBaseID: | FBgn0051680 | Length: | 147 | Species: | Drosophila melanogaster |
| Alignment Length: | 152 | Identity: | 46/152 - (30%) |
|---|---|---|---|
| Similarity: | 68/152 - (44%) | Gaps: | 29/152 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 LGLVTAQGPSEEIAEIDAEVTKKLKSFLENFTGYWKDNTEFLNWIAKIRLALNNNSTDLAYKFEL 74
Fly 75 RYGFESYNKERLVLEQQILDRVEDLDSIIPHQKHAK-CLNFYVDQRNALKTALKQSNSKKIERFA 138
Fly 139 ENSPSCPY----------YYFD 150 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45449849 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0008555 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.930 | |||||