DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43090 and CG33325

DIOPT Version :8

Sequence 1:NP_001245546.1 Gene:CG43090 / 12798122 FlyBaseID:FBgn0262536 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_996182.2 Gene:CG33325 / 2768664 FlyBaseID:FBgn0053325 Length:313 Species:Drosophila melanogaster

Alignment Length:134 Identity:37/135 (27%)
Similarity:63/135 (47%) Gaps:14/135 (10%)


  Fly    20 EEIAEIDAEVTKKLKSFLENFTG---YWKDNTEFLNWIAKIRLALNNNSTDLAYKFELRYGFESY 81
            |.:|:.||..|..||.....|..   ..:.|.||......:.:|||.:..::|.|.::...|..|
  Fly    30 ESLAKTDAMYTALLKEINSTFHKRPLLAEKNAEFEKNFQTVLVALNLSMYEIATKIDVYTDFTVY 94

  Fly    82 NKERLVLEQ------QILDRVEDLDSIIPHQKHAKCLNFYVDQRNALKTALKQSNSKKIERFAEN 140
            |:.||.||:      |:.:|::.:::::|     .|..|:.:|:..|..:..|||..|:|.....
  Fly    95 NQIRLELEREIFKKLQVAERLQKMENLMP-----TCRIFFANQQVQLIGSFSQSNLMKLEILNHP 154

  Fly   141 SPSC 144
            .|.|
  Fly   155 GPEC 158



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133418870
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.