DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43295 and AT1G71760

Sequence 1:NP_001246788.1 Gene:CG43295 FlyBaseID:FBgn0262987 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001077810.1 Gene:AT1G71760 AraportID:AT1G71760 Length:276 Species:Arabidopsis thaliana

Alignment Length:153 Identity:48/154 (31%)
Similarity:72/154 (47%) Gaps:15/154 (10%)


  Fly     8 VQCIQCKMYQVDFVKKAST-WQCKICRQKQSLLKEFFRG-SAAECRVKVQHLNLERGM-QEECLN 69
            :||.:|...||...||:|. |.|.||.||||:.|.|.:| .|.|.|..||..|:.|.: .||...
plant     9 LQCYECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGYKAKELRFFVQSFNMSRKVADEEAHA 73

  Fly    70 TGLFLTAKQQLEEEKDCQEKEENTTPQKKTNKWANYVD-NTIETTQKPAAKPTKTDELSDEISMN 133
            .|   .:..::..|.:..|:...|   ||.:.|:.|:| :::...::.|.:......:::..|..
plant    74 VG---DSFPEVYVEGEVNEEVNGT---KKRSDWSQYLDFDSVNDRRRLAGEEDDVKIVTEMPSNM 132

  Fly   134 FK-----KTRNTGPRSSKRSAEN 151
            ||     |..|.|..||....||
plant   133 FKRPKLNKESNAGGSSSNTGGEN 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43295NP_001246788.1 UPF0544 7..102 CDD:292377 34/97 (35%)
AT1G71760NP_001077810.1 UPF0544 8..100 CDD:292377 34/97 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146272at2759
OrthoInspector 1 1.000 T193314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15863
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.