DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43295 and mrnip

Sequence 1:NP_001246788.1 Gene:CG43295 FlyBaseID:FBgn0262987 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001296775.1 Gene:mrnip ZFINID:ZDB-GENE-051113-228 Length:392 Species:Danio rerio

Alignment Length:187 Identity:60/188 (32%)
Similarity:93/188 (49%) Gaps:25/188 (13%)


  Fly     1 MSQQIRVVQCIQCKMYQVDFVKKASTWQCKICRQKQSLLKEFFRGSAAECRVKVQHLNLERGMQE 65
            |.|:..|::|..|:.:||..||||..|.||:|.:||||:|||.||:||:||..||.||..||.|.
Zfish     1 MVQEFNVLRCFSCQTFQVQQVKKAKKWTCKVCGEKQSLIKEFGRGAAADCRRHVQKLNALRGEQH 65

  Fly    66 ECLNTGLFLTAKQQLEEEKDCQEKEENTTPQKK--TNKWANYVDNTIE-------------TTQK 115
            : |||...|....:..|.:|..|..:..:.|.:  .::|:.|.|.|.|             .|::
Zfish    66 Q-LNTQQLLAQGDEENENEDVYEVLDPKSEQGEAHVSRWSKYTDQTTEGPNEEEEDEDENVYTER 129

  Fly   116 PAAKPTKTDELSDEISM--------NFKKTRNTGPRSSKRSAENMPTVTKKICSKWN 164
            |..:...|.:.....|:        |::::| :|....::.|.....:.|:..|.||
Zfish   130 PQFRIQGTRKRKKMSSLEPFGGNCDNYEESR-SGYSQFRKQAHLPLQLEKRSSSSWN 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43295NP_001246788.1 UPF0544 7..102 CDD:292377 41/97 (42%)
mrnipNP_001296775.1 UPF0544 7..103 CDD:292377 41/97 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CI02
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0010022
OrthoInspector 1 1.000 T1051831
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15863
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.