DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chil1 and Mur89F

Sequence 1:NP_031721.2 Gene:Chil1 MGIID:1340899 Length:389 Species:Mus musculus
Sequence 2:NP_001262662.1 Gene:Mur89F FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster

Alignment Length:43 Identity:11/44 (25%)
Similarity:22/44 (50%) Gaps:1/44 (2%)


Mouse    80 WNDESN-YDKLNKLKTRNTNLKTLLSVGGWKFGEKRFSEIASN 121
            |:.|:| .:..::::|:....|.::|.||........|..:||
  Fly  1062 WDPEANSCNHPDQIQTKPLKCKKVVSQGGSSSNSTSNSSSSSN 1104

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Chil1NP_031721.2 Glyco_18 31..366 CDD:214753 11/44 (25%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 11/44 (25%)
Chitooligosaccharide binding. {ECO:0000250} 79..80 11/44 (25%)
Chitooligosaccharide binding. {ECO:0000250} 106..109 2/3 (67%)
Chitooligosaccharide binding. {ECO:0000250} 213..216
Important for AKT1 activation and IL8 production 333..347
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884 3/12 (25%)
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.