DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CNGA4 and CG42260

Sequence 1:XP_016872706.1 Gene:CNGA4 HGNCID:2152 Length:577 Species:Homo sapiens
Sequence 2:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster

Alignment Length:472 Identity:195/473 (41%)
Similarity:294/473 (62%) Gaps:8/473 (2%)


Human     8 KTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPDLQHGYLVAWLVL 72
            :|......|.:.||||..|.||:|...|:|...:....:||..:::.|..|.::....:..|..|
  Fly   554 RTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCL 618

Human    73 DYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLASLMPTDVVYVRLGPHTP 137
            ||.||.|||:|::..|.||:||.|:|..|..::.:.|:.:..|::|...|:|.|.:|:.:| ...
  Fly   619 DYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIG-FNS 682

Human   138 TLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWV 202
            .||..|.::..|.:...||||..|.|||.||...|:.|:.|:.|||.|||..:.:..|||...||
  Fly   683 ILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWV 747

Human   203 YPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYLFMVGDFLLAVMGFATIMGSMSS 267
            |.|.....   :.:|||.|:|:.||.|||:||.|.|..:.||:|::...|..:|.|||::|.:::
  Fly   748 YHDSESAD---VVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVAN 809

Human   268 VIYNMNTADAAFYPDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRA 332
            ::.:::.|...|......||.||:::.|...|:.:||.|:.:|.:.:|.::|...:..||::|:|
  Fly   810 IVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKA 874

Human   333 EVAVSVHLSTLSRVQIFQNCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVA 397
            |:|::|||.||.||:||||.||..|.||||:|:|..:|||:|:||||::|:||||:..|:|.|||
  Fly   875 EIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVA 939

Human   398 DDGITQYAVLGAGLYFGEISIINIKATGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQA 462
            |:|.|..|.|.||.|||||||:|:    ..:||||||:::|:||||||.|||:|:.:||.|||.|
  Fly   940 DNGKTVMASLKAGSYFGEISILNM----GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAA 1000

Human   463 QTIMEEKGREILLKMNK 479
            :..:|....:.|.|..|
  Fly  1001 RVRLESIAVKRLEKYKK 1017



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.