DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CNGA1 and CG42260

Sequence 1:XP_005248106.2 Gene:CNGA1 HGNCID:2148 Length:765 Species:Homo sapiens
Sequence 2:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster

Alignment Length:558 Identity:233/559 (42%)
Similarity:335/559 (60%) Gaps:55/559 (10%)


Human   123 SASTSEESENENPHARGSFSYKSLRKGGPS---------QREQYLPGAIALFNVNNSSNKDQEPE 178
            ||||    .:.:|||.|..|     :|||.         ....:..||.:.......|:..|...
  Fly   494 SAST----VSHHPHAHGPPS-----QGGPGGPGPPHGGHPHHPHHGGAGSGGGSGPGSHGGQPHH 549

Human   179 EKKKKKKEKKSKSDDKNENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNW 243
            :|.::...::.::                               ....:|...|.||:|...|.|
  Fly   550 QKPRRTASQRIRA-------------------------------ATAARKLHFVFDPAGRLCYYW 583

Human   244 LFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEE 308
            ...:::..:||:.::|.|..|.|:....:..|..|||:||.:||||:....||||||.|:|..:.
  Fly   584 SMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDA 648

Human   309 LKLINKYKSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIF 373
            |||...|.::..|.:|.|.|:|.|.||..:|:| ..:|..||::..|.:.|..|||..|||||:|
  Fly   649 LKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFN-SILRSFRLVKIYRFWAFMDRTERHTNYPNLF 712

Human   374 RISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTLTTI 438
            |.:.|:.|:::|.|||.|:::.|.|..|||:..|||   :|.|...:.::|:.|.||.||.||||
  Fly   713 RSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY---HDSESADVVKQYLQSYYWCTLALTTI 774

Human   439 GETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSK 503
            |:.|.|....|||||::..|.|:::|||::|::.:::::::|||.||||::|.:|.||..|.|..
  Fly   775 GDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPN 839

Human   504 DMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVL 568
            .::.:|||||||||..:|..||:..:..|||||:|||||||||||||:|.||.:.|||.|.||||
  Fly   840 HLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVL 904

Human   569 KLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAG 633
            :|:|.::|||||||:||::|:||||:..|:|.||||:|.|....|..|||||||||||:  ..||
  Fly   905 RLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAG 967

Human   634 NRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLE 671
            |||||:::|:||||||.|||.|:.:.|.|||.|:..||
  Fly   968 NRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLE 1005



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.