DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Scarb2 and santa-maria

Sequence 1:NP_031670.1 Gene:Scarb2 MGIID:1196458 Length:478 Species:Mus musculus
Sequence 2:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster

Alignment Length:436 Identity:130/437 (30%)
Similarity:228/437 (52%) Gaps:35/437 (8%)


Mouse    34 DQTIEKNMVLQNGTKVFNSWEKPPLPVYIQFYFFNVTNPEEILQGEI---PLLEEVGPYTYRELR 95
            |..:.|.|.|...|:|:.:|:.||:.:.:..|.:|.||||:.  |.:   |:||:||||.:.|..
  Fly    42 DWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDF--GNLSTKPILEQVGPYRFIERP 104

Mouse    96 NKANIQFGENGTTISAVTNKAYVFERNQSVGDPNVDLIRTINIPLLTVVDLAQL--TLLRELIEA 158
            :|.:|.:.....:::......:.|:...|.|..: |.|.|:|...|:....|:.  .:.|.|::.
  Fly   105 DKVDIHWHPENASVTYRRRSLFYFDAAGSNGSLD-DEITTLNAVALSAAATAKYWPPVKRSLVDV 168

Mouse   159 MLKAYQQKLFVIHTVHELLW-GYKDEILSL---VHIFKPDVS---PNFGLFYERNGTND--GEYV 214
            .||.|..::.|..::.|||: ||.|.::.:   :.||..:|.   ..||.||.|||:.|  |.:.
  Fly   169 GLKMYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVFN 233

Mouse   215 FLTGEDNYLNFSKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPL-ISKDEVLYLFPSDLCRSVH 278
            ..||.|......::..||.:.:..::.: .|.|.||:.|: |.|. :...:.:.||..|:||::.
  Fly   234 VFTGADQLAKLGQMHSWNYQENTGFFDS-YCGMTNGSAGE-FQPQHLKPGDSVGLFTPDMCRTIP 296

Mouse   279 ITFSSFENVEGLPAFRYKVPAEILANTS---ENAGFCIPEGNCMDSGVLNISICKNGAPIIMSFP 340
            :.:....::|||..:::......:.|.:   ||..||  .|.|:.|||:|||.|:.|:|:.||:|
  Fly   297 LDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFC--GGQCVPSGVMNISSCRFGSPVFMSYP 359

Mouse   341 HFYQADEKFVSAIKGMHPNKEEHESFVDINPLTGIILRGAKRFQINTYVRKLDDFVETGDIRTMV 405
            ||:.||..:...::|:.||:::||.::.:.|.|||.|..|.|||:|..|..:........|..:.
  Fly   360 HFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIF 424

Mouse   406 FPVMYLNESVLIDKETANQLKSVINTTLVVTNIPYIIMALGVFFGL 451
            ||:::..:.|.|..:.|:|||.          :|.::::..:|.|:
  Fly   425 FPLVWFEQKVRITPDMADQLKV----------LPIVMLSGHIFAGI 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Scarb2NP_031670.1 CD36 28..455 CDD:279474 130/437 (30%)
Important for interaction with GBA 155..191 12/40 (30%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 130/437 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.