DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cd36 and santa-maria

Sequence 1:NP_001153027.1 Gene:Cd36 MGIID:107899 Length:472 Species:Mus musculus
Sequence 2:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster

Alignment Length:499 Identity:139/500 (28%)
Similarity:246/500 (49%) Gaps:55/500 (11%)


Mouse     2 GCDRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEKTIKREVVLEEGTTAFKNWVKTGTTVYRQFW 66
            |...|..||.| :.|..|.:||.:.......|.:..:.:|:.|...|..::||......:....:
  Fly    10 GQKSNRKLIIG-IFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIY 73

Mouse    67 IFDVQNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGAIFEPSLSVGTE 131
            :::..||:|....|:|..::|.|||.: :....|.:|...||:.:|::.:.:...|:.:.|.|:.
  Fly    74 LYNWTNPEDFGNLSTKPILEQVGPYRF-IERPDKVDIHWHPENASVTYRRRSLFYFDAAGSNGSL 137

Mouse   132 DDNFTVLN-LAVAAA------PHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLW-GYKDPFLS 188
            ||..|.|| :|::||      |.: :.|.|.|.|    |...:.|...:|:.|||: ||.|..:.
  Fly   138 DDEITTLNAVALSAAATAKYWPPV-KRSLVDVGL----KMYGAEMSVQKSIDELLFTGYNDAMID 197

Mouse   189 L------------VPYPISTTVGVFYPYNDTVD--GVYKVFNGKDNISKVAIIESYKGKRNLSYW 239
            :            ||:   ...|.||..|.:.|  ||:.||.|.|.::|:..:.|:..:.|..::
  Fly   198 VAMAMPIFGDEVKVPF---DKFGWFYTRNGSADLTGVFNVFTGADQLAKLGQMHSWNYQENTGFF 259

Mouse   240 PSYCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEIDLKGIPVYRFVLPANAFASPL 304
            .|||.|.||:.....|..::...::..|:.|:||:|...:...:|::|:..|:|.....:..:..
  Fly   260 DSYCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGT 324

Mouse   305 QNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGKPVYISLPHFLHASPDVSEPIEGLHPNEDEHRT 369
            |.|:|.|||     ...|...||::|..|:.|.||::|.|||.:|.|...:.:|||.||:.:|..
  Fly   325 QYPENLCFC-----GGQCVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEF 384

Mouse   370 YLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEKAEMFKTQV 434
            |:.|:|.||..|:.|.|.|||:||:|.:.|.....:.|.:. |::|..:...|..:.|:      
  Fly   385 YMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIFF-PLVWFEQKVRITPDMAD------ 442

Mouse   435 TGKIKLLGMVEMA---------LLGIGVVMFVAFMISYCACKSK 469
              ::|:|.:|.::         ::||.::.:....|...:|:::
  Fly   443 --QLKVLPIVMLSGHIFAGICLIVGITLLCWTPVQILLASCRNR 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cd36NP_001153027.1 CD36 16..461 CDD:279474 132/476 (28%)
Required for interaction with thrombospondins, THBS1 and THBS2. {ECO:0000269|PubMed:15748999} 93..120 5/27 (19%)
Interaction with PTK2, PXN and LYN. {ECO:0000250|UniProtKB:P16671} 460..472 2/11 (18%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 132/474 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1.030639 Normalized mean entropy S6187
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000266
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11923
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.