DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctnna2 and alpha-Cat

Sequence 1:XP_017176860.1 Gene:Ctnna2 MGIID:88275 Length:966 Species:Mus musculus
Sequence 2:NP_524219.1 Gene:alpha-Cat FlyBaseID:FBgn0010215 Length:917 Species:Drosophila melanogaster

Alignment Length:962 Identity:584/963 (61%)
Similarity:735/963 (76%) Gaps:68/963 (7%)


Mouse    12 GSMTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAAS 76
            |::|. ...|.||||||:|||||::||:.|||||.||||||||  ||||.||||:||:|..|.|:
  Fly     8 GTLTD-FGQIALKWDPKNLEIRTMSVEKTLEPLVLQVTTLVNT--KGPSKKKKGKSKRASALVAA 69

Mouse    77 VEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAAR 141
            ||:||:||::||||||.|:.|:.:|::.||::|:|.|:.|.||:.||::|||||:|||.||||||
  Fly    70 VEKATENFIQKGEQIAYENPDITQEMLTAVDEVKKTGDAMSIAAREFSEDPCSSLKRGNMVRAAR 134

Mouse   142 ALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARR 206
            .||||||||||||||.||..||..|.|||:.|..:|||:::.:|.:..::||:...:|...||:|
  Fly   135 NLLSAVTRLLILADMVDVHLLLKSLHIVEDDLNKLKNASSQDELMDNMRQFGRNAGELIKQAAKR 199

Mouse   207 QQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISSAA 271
            |||||||..||::||||..|||::|||.|||:.::|||::...:.|||::.|||.:|:..||..|
  Fly   200 QQELKDPQLRDDLAAARAMLKKHSTMLLTASKVYVRHPELDLAKVNRDFILKQVCDAVNTISDVA 264

Mouse   272 QATS--PTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSS 334
            |..|  |||.   ::|.|||||||::||..|::||||:||.|.|..||||||||||.||||||:.
  Fly   265 QGKSSQPTDI---YSGAGELAAALDDFDEGIVMDPMTYSEKRSRQLLEERLESIISAAALMADAD 326

Mouse   335 CTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMD 399
            ||||:||||||||||||||||||||||||:|..:|:....|:.|||:|.:|||||||||||||:|
  Fly   327 CTRDERRERIVAECNAVRQALQDLLSEYMSNMSQKDNSPGLSRAIDQMCRKTRDLRRQLRKAVVD 391

Mouse   400 HISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMA 464
            |:|||||||..|||.|||||||||||:|:|.:::|.:||.||||||||.||:||||:|||:||.|
  Fly   392 HVSDSFLETTTPLLDLIEAAKSGNEKKVREKSEIFTKHAEKLVEVANLVCSMSNNEDGVKMVRYA 456

Mouse   465 ATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENH 529
            |.||:||||||||||..|..||.|||||:||..::..||.|||:|||||||||::||||:|||||
  Fly   457 AAQIESLCPQVINAASILTVRPNSKVAQENMTTYRQAWEVQVRILTEAVDDITTIDDFLAVSENH 521

Mouse   530 ILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETV 594
            |||||||||:|||.||...|..|||||:||::||.:::.|||:|||..:||::||||.|:|.:.|
  Fly   522 ILEDVNKCVMALQVGDARDLRATAGAIQGRSSRVCNVVEAEMDNYEPCIYTKRVLEAVKVLRDQV 586

Mouse   595 MPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQ-E 658
            |.:|.::|..|:.|||.|..:..:||:|||||||||||||:||:||||.|:.|:|:.|::||. |
  Fly   587 MMKFDQRVGAAVGALSNNSNKDVDENDFIDASRLVYDGVREIRRAVLMNRSSEDLDTDTEFEPVE 651

Mouse   659 D--YDVRSRTSVQTEDDQL-----IAG-QSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVA 715
            |  .:.|||:|..|.|..:     |:| .:||..|.::.:|:|.|||:|||:|.:||...|:|||
  Fly   652 DLTLETRSRSSAHTGDQTVDEYPDISGICTAREAMRKMTEEDKQKIAQQVELFRREKLTFDSEVA 716

Mouse   716 KWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCP 780
            ||||:|||||.|||.||||||||||||||:||||.|.|||||||||:|||:::|||.|.:|:|||
  Fly   717 KWDDTGNDIIFLAKHMCMIMMEMTDFTRGRGPLKTTMDVINAAKKISEAGTKLDKLTREIAEQCP 781

Mouse   781 DSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGR 845
            :|:.|:|||||||||||||||:.|.|||||:|||:.|||||||                      
  Fly   782 ESSTKKDLLAYLQRIALYCHQIQITSKVKADVQNISGELIVSG---------------------- 824

Mouse   846 ASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTA 910
                                      |||||||||||||||||||||||.||||||||.: .|| 
  Fly   825 --------------------------LDSATSLIQAAKNLMNAVVLTVKYSYVASTKYTR-QGT- 861

Mouse   911 AVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKA 962
             |:||:|.||||||||||||:.|||||.:.:||:|||||..:|:.|||||::
  Fly   862 -VSSPIVVWKMKAPEKKPLVRPEKPEEVRAKVRKGSQKKVQNPIHALSEFQS 912

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctnna2XP_017176860.1 Vinculin 94..927 CDD:279395 508/844 (60%)
alpha-CatNP_524219.1 Vinculin 87..877 CDD:279395 508/844 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 1 1.000
Homologene 1 1.000 H68394
Inparanoid 1 1.050 1087 1.000 Inparanoid score I239
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001371
OrthoInspector 1 1.000 T615713
orthoMCL 1 0.900 OOG5_130411
Panther 1 1.100 LDO PTHR18914
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2575
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.