DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Casp3 and Strica

Sequence 1:NP_001271338.1 Gene:Casp3 MGIID:107739 Length:277 Species:Mus musculus
Sequence 2:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster

Alignment Length:245 Identity:71/246 (29%)
Similarity:104/246 (42%) Gaps:56/246 (23%)


Mouse    49 IINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSS 113
            |.|::.|....  ..|.|:..|...||.||..||.:|....|.|...|.:.:..:..:|...:|:
  Fly   317 IFNHERFDNKN--EFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSA 379

Mouse   114 FVCVILSHG---------------DEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQAC 163
            .|.||||||               |:.|::    |: |:.          |:|..||||..:|||
  Fly   380 LVLVILSHGTRHDQIAAKDDDYSLDDDVVF----PI-LRN----------RTLKDKPKLIFVQAC 429

Mouse   164 RGTELDC---GIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKL 225
            :|   ||   |..||       |.|......:.|..|||..|:.|:| ::||:.|||:||..|..
  Fly   430 KG---DCQLGGFMTD-------AAQPNGSPNEILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNR 483

Mouse   226 YAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYF 275
            .....:...|:..|.:.|..:.:.          :|||.:.|.||.:..|
  Fly   484 SGKTSDIDTIMMNVRQVVKMQSKD----------RQIPSVTSTLTSKYVF 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Casp3NP_001271338.1 CASc 37..277 CDD:214521 71/246 (29%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.