DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk2a and AMPKalpha

DIOPT Version :9

Sequence 1:XP_006525604.1 Gene:Camk2a / 12322 MGIID:88256 Length:489 Species:Mus musculus
Sequence 2:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster


Alignment Length:265 Identity:104/265 - (39%)
Similarity:151/265 - (56%) Gaps:20/265 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 YQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARD-HQKLEREARICRLLKHPNIVRLH 76
            |.|...||.|.|..|:.....:...:.|.||:|.:|:.:.| ..|:.||.:..:|.:||:|::|:
  Fly    28 YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLY 92

Mouse    77 DSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENL 141
            ..||.....::|.:.|:|||||:.||......|..|....|||:..|.:||:..:||||||||||
  Fly    93 QVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENL 157

Mouse   142 LLASKLKGAAVKLADFGLA-IEVEGEQQAWFGF----AGTPGYLSPEVLRKDPYGKP-VDLWACG 200
            ||...:.   ||:|||||: :.::||      |    .|:|.|.:|||:....|..| ||:|:||
  Fly   158 LLDHNMH---VKIADFGLSNMMLDGE------FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCG 213

Mouse   201 VILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEA 265
            ||||.||.|..||.||....|:::||:|.  ||.||:  :..:..:|:.:||.::|.||....|.
  Fly   214 VILYALLCGTLPFDDEHVPTLFRKIKSGI--FPIPEY--LNKQVVNLVCQMLQVDPLKRANIEEI 274

Mouse   266 LKHPW 270
            .||.|
  Fly   275 KKHEW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk2aXP_006525604.1 STKc_CaMKII 11..302 CDD:270988 104/265 (39%)
CaMKII_AD 357..484 CDD:285524
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 104/265 (39%)
UBA_AID_AMPKalpha 297..360 CDD:270521
AMPKA_C 457..580 CDD:213378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.