DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk2a and CASK

DIOPT Version :9

Sequence 1:XP_006525604.1 Gene:Camk2a / 12322 MGIID:88256 Length:489 Species:Mus musculus
Sequence 2:NP_001262811.1 Gene:CASK / 42567 FlyBaseID:FBgn0013759 Length:929 Species:Drosophila melanogaster


Alignment Length:307 Identity:131/307 - (42%)
Similarity:189/307 - (61%) Gaps:17/307 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 FTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKK------LSARDHQKLEREARICRLL 67
            |.:.|:|.|.:|||.||:||||:...:.|::|.||::..|      ||..|   |:|||.||.:|
  Fly     8 FDDVYELCEVIGKGPFSIVRRCIHRESNQQFAVKIVDVAKFTASPGLSTAD---LKREATICHML 69

Mouse    68 KHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVARE----YYSEADASHCIQQILEAVLHCHQ 128
            |||:||.|.::.|.||..|::|:.:.|.:|..::|.|.    .||||.|.|.::|||||:.:||:
  Fly    70 KHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILEALRYCHE 134

Mouse   129 MGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQA--WFGFAGTPGYLSPEVLRKDPYG 191
            ..::|||::|...|||:....|.|||..||.||::.|.::.  ..|..|.|.|::|||:.:..||
  Fly   135 NDILHRDVRPACALLATVDNSAPVKLGGFGSAIQLPGTRETIETHGRVGCPHYMAPEVVTRRLYG 199

Mouse   192 KPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINP 256
            |..|:|..||:|::||.|..||..... ||.|.:..|...|.:|||.:::..||||:.|||..||
  Fly   200 KGCDVWGAGVMLHVLLSGRLPFLGSGV-RLQQSVARGRLSFEAPEWKSISANAKDLVMKMLAANP 263

Mouse   257 SKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKGAI 303
            ..|::..|.|.||||..|..:.. .|..:||:.||::|||||||||:
  Fly   264 HHRLSITEVLDHPWIRDRDKLQR-THLADTVEELKRYNARRKLKGAV 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk2aXP_006525604.1 STKc_CaMKII 11..302 CDD:270988 128/302 (42%)
CaMKII_AD 357..484 CDD:285524
CASKNP_001262811.1 STKc_CASK 8..308 CDD:270996 129/304 (42%)
S_TKc 12..278 CDD:214567 113/269 (42%)
L27 347..396 CDD:280918
L27 406..462 CDD:280918
PDZ_signaling 493..573 CDD:238492
SH3_CASK 586..646 CDD:213014
Guanylate_kin 710..883 CDD:279019
GuKc 720..883 CDD:214504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.