DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk2a and KP78b

DIOPT Version :9

Sequence 1:XP_006525604.1 Gene:Camk2a / 12322 MGIID:88256 Length:489 Species:Mus musculus
Sequence 2:NP_001163587.1 Gene:KP78b / 41361 FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster


Alignment Length:261 Identity:98/261 - (37%)
Similarity:144/261 - (55%) Gaps:9/261 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 YQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHD 77
            |::.:.||||.|:.|:..:.:..|:|.|.|:|:...|:....|||.||..|.:.|.|||||||..
  Fly    63 YKIIKTLGKGNFAKVKLAIHLPTGREVAIKLIDKTALNTIARQKLYREVNIMKKLNHPNIVRLLQ 127

Mouse    78 SISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLL 142
            .|..|...||:.:.|:|||||..:|......|.||....:|::.|:.:||...:||||||.||||
  Fly   128 VIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQLVSAIEYCHSKSIVHRDLKAENLL 192

Mouse   143 LASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKP-VDLWACGVILYIL 206
            |..::|   :|:||||.:...| .:.....|.|:|.|.:||:.|...|..| ||.|:.||:||.|
  Fly   193 LDQQMK---LKIADFGFSTTFE-PKAPLETFCGSPPYAAPELFRGKKYSGPEVDSWSLGVVLYTL 253

Mouse   207 LVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWI 271
            :.|..||...:...|..::..|.|..|.    .|:.|.:.||.|.|.:||::|.:.:..:...||
  Fly   254 VSGSLPFDGTNLKELRDRVLRGKYRVPY----YVSIECESLIRKFLVLNPTQRTSLSAVMADRWI 314

Mouse   272 S 272
            :
  Fly   315 N 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk2aXP_006525604.1 STKc_CaMKII 11..302 CDD:270988 98/261 (38%)
CaMKII_AD 357..484 CDD:285524
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357 96/258 (37%)
S_TKc 63..314 CDD:214567 96/258 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.