DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk2a and CG17528

DIOPT Version :9

Sequence 1:XP_006525604.1 Gene:Camk2a / 12322 MGIID:88256 Length:489 Species:Mus musculus
Sequence 2:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster


Alignment Length:262 Identity:102/262 - (38%)
Similarity:150/262 - (57%) Gaps:8/262 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 YQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHD 77
            |.|...:|.|.|::|.:......|..||.|||:..|...::|. ::.|.|:.:.|.||:|:.|..
  Fly   477 YSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHY-IDAEVRVMKKLNHPHIISLIL 540

Mouse    78 SISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLL 142
            |:.:..:.||:.:.|:||:||:.|.....:||..:...|:.:..|:.:.|.||:||||:||||||
  Fly   541 SVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLL 605

Mouse   143 LASKLKG--AAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYI 205
            :.....|  ..:||||||||.||   ....:...|||.|::||:|.:..||..:|:||.|:||||
  Fly   606 VKLDEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYI 667

Mouse   206 LLVGYPPFW--DEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKH 268
            ||.|:|||.  |..|..|:..|.:|.|:||.|.|..:....:|||..||..:|..|.|:.:.|.|
  Fly   668 LLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDH 732

Mouse   269 PW 270
            .|
  Fly   733 SW 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk2aXP_006525604.1 STKc_CaMKII 11..302 CDD:270988 102/262 (39%)
CaMKII_AD 357..484 CDD:285524
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 101/260 (39%)
S_TKc 477..734 CDD:214567 101/260 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.