DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: C4b and Tep2

Sequence 1:XP_006523594.1 Gene:C4b MGIID:88228 Length:1758 Species:Mus musculus
Sequence 2:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster

Alignment Length:1671 Identity:403/1672 (24%)
Similarity:676/1672 (40%) Gaps:390/1672 (23%)


Mouse    29 SVVNLGTPLS-------VGVQLLDAPPGQEVKGSVFLRNPKGGSCSPKKDFKL---SSGDDFVLL 83
            |||..||..|       |.|...|.|  .::|.|:     .|.|.:..|..:|   |:.:    :
  Fly    24 SVVGPGTLRSNSKYNVVVSVHKADGP--SQIKVSL-----NGPSYNETKQIELPPMSTQN----V 77

Mouse    84 SLEVPLEDVRSCGLFDLRRAPHIQLVAQSPWLRNTAFKATETQGVNLLFSSRRGHIFVQTDQPIY 148
            ..|||   ..:.|.::|          .:..:....||    ....|.::.::..:|||||:..|
  Fly    78 EFEVP---KLATGNYNL----------SAEGVSGVVFK----NSTKLNYADKKPSVFVQTDKATY 125

Mouse   149 NPGQRVRYRVFALDQKMRPS---TDFLTITVENSHGLRVLKKEIFTSTSIFQDAFTIPDISEPGT 210
            .|...|::|:..||:..||:   .....|.::.:........::..:..:|.....:.:....||
  Fly   126 KPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRIKQLSDVKLTKGVFSGELQLSEQPVLGT 190

Mouse   211 WKISARFSDGLESNRST-HFEVKKYVLPNFEVKITPWKPYILMVPSNSDE-IQLDIQARYIYGKP 273
            ||||... ||  .||.| .|||.|||||.|||.:...|..::     :|: |:..|:|:|.||||
  Fly   191 WKISVSV-DG--DNRETKSFEVDKYVLPKFEVIVDTPKAVVI-----ADKVIKATIRAKYTYGKP 247

Mouse   274 VQGVA-------YTRFALMDEQGKRTFLRGLETQAKL--VEGRTHISISKDQFQAALDKINIGVR 329
            |:|.|       |..|..::..|.:        |.|.  |:|:.|:.         .|.|:...|
  Fly   248 VKGKATVSMERSYGYFGDLNANGNK--------QEKTIDVDGKGHVE---------FDIIHWAQR 295

Mouse   330 D--LEGLRLYAATAVIESPGGEMEEAELTSWRFVSSAFSLDLSRTKRHLVPGAHFLLQALVQEMS 392
            .  |..::|:|  .|.|...|..:.|..|. ......:|::......|......|:.|.:|:.:.
  Fly   296 GQYLPPIKLFA--VVTEELTGNKQNATATV-VLHQQRYSIEPYERPEHFEANKSFIYQVVVKNVD 357

Mouse   393 GSEASNVPVKVSATLVS-GSDSQV-------------LDIQQSTNGIGQVSISFPIPPTVTELRL 443
            ||     ||..||..|. |.|...             .:...:.|||...::..|...: ...|:
  Fly   358 GS-----PVTNSAKNVKIGFDKSYSYFHEPSPKTRINFEAPVNENGIATFNVRLPDSDS-RYYRI 416

Mouse   444 LVSAGSLYPAIARLTVQAPPSRGTGFLSIEPL----DPRSPSVGDTFILNLQPVGIPAPTFSHYY 504
            ..|.......|..::...|..     :|.|||    :.:.|.:|:....::    :......::.
  Fly   417 FASFDGSENTIGSISKFEPTP-----MSREPLKIQVNTKKPRLGEQVSFDV----VSIEDLPYFV 472

Mouse   505 YMIISRGQIMAMG----REPRKTVTSVSVLVDHQLAPSFYFV----AYFYHQGHPVANSLLINIQ 561
            |.|::||.::...    .:.:||.|.       :..|:|..|    .|.|   :.|.|.|....:
  Fly   473 YTIVARGNVILSDYVDVPDGQKTYTV-------KFTPTFSMVPKATIYVY---YVVNNDLQFEEK 527

Mouse   562 SRDCEGKLQLKVD--GAKEYRNADMMKLRIQTDSKALVALGAVDMALYAVGGRSHKPLDMSKVFE 624
            :.|.|.:....:|  .....:.::.:||||:||:.:.|.|..||.::..:  :|...|....:|.
  Fly   528 TIDFEKEFSNSIDVSAPTNAKPSEEVKLRIKTDADSFVGLLGVDQSVLLL--KSGNDLSQDDIFN 590

Mouse   625 VINSYNV------GCG--PGGGDDALQVFQDAGLAFSDGDRLTQTREDLSCPKEKKSRQKRNVNF 681
            .:|.|..      |.|  ||         |.:||       :|.|                |.|:
  Fly   591 SLNIYQTSTPWMNGYGRYPG---------QTSGL-------VTLT----------------NANY 623

Mouse   682 QKAVSEKLGQYSSPDAKRCCQDGMTKLPMKRTCEQRAARVPQQACREPFLSCCKFAEDLRRNQTR 746
            .......:..|..                             :..|.|:::..::...:|.:...
  Fly   624 PYNTGPLVMSYVF-----------------------------EGSRHPWITRPRYRVGIRGDSGD 659

Mouse   747 SQAHLARNNHNMLQEEDLIDE--DDILVRTSFPENWLWRVEPVDSSKL-LTVWLPDSMTTWEIHG 808
            ..:.|:::.::...:|.|:.:  ....:|..|||.|.:  |.|...:. ||..:||::|:|.:.|
  Fly   660 RISFLSQSLNDRNLKEILLKQTPQRTTIRKEFPETWFF--ENVGEEEFTLTKKIPDTITSWVVTG 722

Mouse   809 VSLSKSKGLCVAK-PTRVRVFRKFHLHLRLPISIRRFEQFELRPVLYNYLNDDVAVSV------- 865
            .||:.:.|:.:.| |:::|||:.|.:...||.|::|.|...:..|::|||:..:...|       
  Fly   723 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQ 787

Mouse   866 --HVTPVEGLCLAGG---GMMAQQVTVPAGSARPVAFSVVPTAAANVPLKVVARGVFDLGDAVSK 925
              ..|......|...   ....::||:||.|.:.|:|.:.|.......||:.|.... .|||:.:
  Fly   788 EYEFTEATNEVLEKAIDEVRRVKRVTIPANSGKSVSFMIRPKNVGFTTLKITATSAL-AGDAIHQ 851

Mouse   926 ILQIEKEGA--IHREELVYNLDPLNNLGRTLEIPGSSDPN-IVPDGDF--SSLVRVTASEPLETM 985
            .|::|.||.  .....:..||.....:.::|:   :..|| :||..:|  .|:|.......|:.:
  Fly   852 KLKVEPEGVTLFENRAVFINLKDQPEMSQSLD---ADIPNEVVPQSEFIEFSVVGDLLGPTLQNL 913

Mouse   986 GSEGALSPGGVASLLRLPQGCAEQTMIYLAPTLTASNYLDRTEQWSKLSPETKDHAVDLIQKGYM 1050
            .           :|:|:|.||.||.|:...|.:....||:.|.:  || |..:..|...::.||.
  Fly   914 D-----------NLVRMPYGCGEQNMVNFVPNILVLKYLEVTGR--KL-PSVESKARKFLEIGYQ 964

Mouse  1051 RIQQFRKNDGSFGAWLHRDS--STWLTAFVLKILSLAQEQVGNSPEKLQETASWLLAQQLGDGSF 1113
            |...::.:|||:.|:...|:  ||||||:|::....|.......|:.:.....:|:::|...|.|
  Fly   965 RELTYKHDDGSYSAFGKSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEF 1029

Mouse  1114 HDPCPVIHRAMQGGLVGSDETVALTAFVVIALHHGLDVFQDDDAKQLKNRVEASITKANSFLGQK 1178
            .:...:...|.|..|       |||:||::|.      |::   .:|..:.:::|.||..::.::
  Fly  1030 PEVGKLFDNANQNPL-------ALTSFVLLAF------FEN---HELIPKYQSAIKKAVRYVAEE 1078

Mouse  1179 ASAGLLGAHAAAITAYALTLTKASEDLRNVAHNSLMAMAEETGEHLYWGLVLGS--QDKVVLRPT 1241
            |.. ....::.||.|.||.|.|..:..:.:|  .|.::|.:..:.::|.....|  :|..|.. .
  Fly  1079 ADK-TDDQYSLAIAAVALQLAKHPQSEKVIA--KLESVARKENDRMWWSKATESTGEDGRVFH-W 1139

Mouse  1242 APRSPTEPVPQAPALWIETTAYALLHLLLREGKGKMADKA---ASWLTHQGSFHGAFRSTQDTVV 1303
            .|||..          :|.|:|.||.||.::    .|:||   ..||..|.:.:|.|.||||||:
  Fly  1140 KPRSND----------VEITSYVLLALLEKD----PAEKALPIIKWLISQRNSNGGFSSTQDTVI 1190

Mouse  1304 TLDALS--AYWIASHTTEEKALNVTLSSMG--RNGLKT---HGLHLNNHQVKGLEEELKFSLGST 1361
            .|.||:  ||...|.:   ..:::..||.|  :|.:|.   :.|.|..|.:.....::.|:...|
  Fly  1191 GLQALTKFAYKTGSGS---GTMDIEFSSAGESKNTIKVNPENSLVLQTHDLPKSTRKVDFTAKGT 1252

Mouse  1362 ISVKV---------EGNSKGTLKILRTYNVLDMKNTTCQDLQIEVKVTGAVEYAWDANEDYEDYY 1417
            .|..|         |...|.:.|:..|     :|:|..|.|.::|    ..||            
  Fly  1253 GSAMVQLSYRYNLAEKEKKPSFKVTPT-----VKDTPNQLLIVDV----CAEY------------ 1296

Mouse  1418 DMPAADDPSVPLQPVTPLQLFEGRRSRRRREAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADI 1482
                     |||:                 :|.|..:                    |.||:.:|
  Fly  1297 ---------VPLE-----------------DADKDKD--------------------SNMAVMEI 1315

Mouse  1483 TLLSGFHALRADLEKLTSLSDRYVSHFETDGPH--VLLYFDSV-PTTRECVGFGASQEVVVGLVQ 1544
            .|.|||......|.|:.:: || |...||....  |::||||: |....|:...||:...|...:
  Fly  1316 ALPSGFVGDSTSLGKIQAV-DR-VKRVETKNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAKQK 1378

Mouse  1545 PSSAVLYDYYSPDHKCSVFYAAPTKSQLLATLCSGDVCQ---CAEG 1587
            |:|..|||||..:.|.:.:|      |:.::||  |:|:   |.||
  Fly  1379 PASVSLYDYYDTERKATEYY------QVKSSLC--DICEGADCGEG 1416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
C4bXP_006523594.1 A2M_N 139..231 CDD:280081 28/96 (29%)
A2M_N_2 475..608 CDD:285005 31/147 (21%)
ANATO 686..752 CDD:237984 5/66 (8%)
A2M 780..867 CDD:278630 29/98 (30%)
complement_C3_C4_C5 992..1311 CDD:239226 94/328 (29%)
A2M_comp 1047..1313 CDD:284982 79/275 (29%)
A2M_recep 1475..1564 CDD:284981 33/92 (36%)
NTR_like 1582..1736 CDD:295338 4/10 (40%)
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 28/97 (29%)
A2M_N_2 445..576 CDD:285005 30/145 (21%)
A2M 694..782 CDD:278630 29/90 (32%)
A2M_2 909..1198 CDD:239227 94/337 (28%)
A2M_comp 961..1199 CDD:284982 77/272 (28%)
A2M_recep 1308..1398 CDD:284981 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119622425
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.