DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bax and Debcl

DIOPT Version :8

Sequence 1:XP_011249082.1 Gene:Bax / 12028 MGIID:99702 Length:221 Species:Mus musculus
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster

Alignment Length:215 Identity:44/216 (20%)
Similarity:78/216 (36%) Gaps:72/216 (33%)


Mouse     4 SGEQLGSGGP------TSS---------------EQIMKTGAFLLQGFIQDRAGRMAGETPELTL 47
            :|..|.:|||      |||               ..|:..|..|...:|:.|. |.||       
  Fly    61 NGRSLHAGGPMTRAASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRARL-RRAG------- 117

Mouse    48 EQPPQDASTKKLSECLRRIGDELDSNM-------------ELQRMIADV---------------- 83
                  ...:|:::.||.|.|...|::             ||:||...|                
  Fly   118 ------VLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGEL 176

Mouse    84 -DTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRER 147
             |:|....:...||.|:|. .:..||:::::|.......:..:.....:.::.::....:.:.:.
  Fly   177 EDSDMAPMLLNLVAKDLFR-SSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDD 240

Mouse   148 LLVWIQDQGGW------VRP 161
            |:.|:.|.|||      :||
  Fly   241 LVYWLIDNGGWLGLSRHIRP 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BaxXP_011249082.1 bcl-2 5..>158 CDD:273308 41/204 (20%)
Bcl-2_like 25..159 CDD:132900 32/170 (19%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 31/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.