DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SERPINA3 and Spn88Eb

Sequence 1:NP_001076.2 Gene:SERPINA3 HGNCID:16 Length:423 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster

Alignment Length:400 Identity:106/400 (27%)
Similarity:183/400 (46%) Gaps:48/400 (12%)


Human    55 DFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSF 119
            ||:.:|.||:....|..|:.|||.|...||......:...|..|:.:.|..... .::.::..|:
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA-LNKQQVLVSY 103

Human   120 QHLLRTLNQSSDE-------LQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQ-DSAAA 176
                 ||.|..||       ::||..|.:||...:::.::|.   ..|||:.. ..||: |....
  Fly   104 -----TLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFN---TLLYGATK-ELDFKNDPETG 159

Human   177 KKLINDYVKNGTRGKITDLI--KDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWV 239
            .|.|||::.:.|..:|.|::  :::...||:||.|..:.|.:|...|..::|....|::::::..
  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224

Human   240 MVPMM---SLHHLTIPYFRDEELSCTVVELKY----------------TGNASALFILPDQDK-- 283
            ||.||   ....:||    ||.|...:::|.|                ..:.|.:.|||:.:|  
  Fly   225 MVYMMHKTGAFKMTI----DEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKIS 285

Human   284 MEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITG 348
            :..|.:.|..:::|:|.:....::| ||.||||...:...|..||..:|:...||..|....:|.
  Fly   286 LNRVISRLNADSVKKWFERALPQKI-ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTA 349

Human   349 -ARNLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIF 412
             ..:|.:....|.|.:.|.|.|:.|:|||.:.::..|...:. |....|.||:.:|.......|.
  Fly   350 DPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDP-TKFNCNHPFVFLIYDEKVDTIL 413

Human   413 FMSKVTNPKQ 422
            |....::|:|
  Fly   414 FAGVYSDPRQ 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SERPINA3NP_001076.2 alpha-1-antitrypsin_like 52..417 CDD:239011 104/394 (26%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 104/394 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.