DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8a1 and CG33298

Sequence 1:XP_017176112.1 Gene:Atp8a1 MGIID:1330848 Length:1177 Species:Mus musculus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1342 Identity:409/1343 (30%)
Similarity:648/1343 (48%) Gaps:313/1343 (23%)


Mouse     5 PSMAPGSSYSGRGRLTHNQGARK------------PPGYEK-------TDDVSEKTSLADQEEVR 50
            || ||.|:..|||   |::.|.:            ||.:::       |.|..|:.|      .|
  Fly   174 PS-APTSATGGRG---HSRQASRSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERS------YR 228

Mouse    51 TIFINQ---PQLTK-------FCNNHVSTAKYNVITFLPRFLYSQFRRAANSFFLFIALLQQIPD 105
            |:..|.   |:..|       |..|.:.|.||.:::|:|:.|..||.|.||.:|:||.||..:|:
  Fly   229 TVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPE 293

Mouse   106 VSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVL--RNGAWEIVHWEKVAVGE 168
            :|..|:...::|:||:|.|.|:|::.||.:|..:|..:|....:|.  ....::.|.|:::.||:
  Fly   294 ISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGD 358

Mouse   169 IVKVTNGEHLPADLLSLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDIDSLMRISGRIE 233
            ||.::|.|.:|||:|.|.:|:||.:|||:|.:||||||||.|:.:....:::.|....:...|:|
  Fly   359 IVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVE 423

Mouse   234 CESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPL 298
            .::|...||.|.|.:.......||:..:.:|||.::|:||.::.|||||.||:||.|.|::.|..
  Fly   424 ADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRY 488

Mouse   299 KLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHYGGASNFGLN------F 357
            |.|.||:..|:.::....||:.:.:|.::|..:|....:    :..:.|...:....|      |
  Fly   489 KRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFT----HFPVPYLPPNKLTANMESMWIF 549

Mouse   358 LTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSD 422
            .|:|::...:||:||.||:|:.|..|.:.|:.::|:....|:.....|..|:.|||||:::||:|
  Fly   550 WTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTD 614

Mouse   423 KTGTLTCNVMQFKKCTIAGVAYGHVPEPEDYGCSPDEWQSSQFGDEKTFNDPS-----LL--DNL 480
            ||||||.|.|.|::|.:.|..|.|.|              |:.  ||.::.|.     |:  |||
  Fly   615 KTGTLTENKMIFRRCVVNGSDYNHPP--------------SEL--EKIYSKPGAPAPPLIPNDNL 663

Mouse   481 QNN----------HPTAPIICEFLTMMAVCHT----AVPERE----------------------- 508
            .::          .|.|..|.|||.::|:|:|    |.|.|:                       
  Fly   664 NSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHG 728

Mouse   509 ----------------------------------------------------------------- 508
                                                                             
  Fly   729 KQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQP 793

Mouse   509 -------------------------------------------GDKI------------------ 512
                                                       ..||                  
  Fly   794 TLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKL 858

Mouse   513 ----------------IYQAASPDEGALVRAAKQLNFVFTGRTPDSVIID--SLGQEERYELLNV 559
                            :|:|.||||.|||.||...:.....|:|:.:::.  ..|....||:|.|
  Fly   859 PSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKV 923

Mouse   560 LEFTSARKRMSVVVR-TPSGKLRLYCKGADTVIYERLAETSK------YKEITLKHLEQFATEGL 617
            |.|.|:||.||:||| ..|.::.||.||||:.|...|...|.      .:|.|.:.|:::|.|||
  Fly   924 LPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGL 988

Mouse   618 RTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPE 682
            |.|..|...::.:|:.:|.|.:.....|::||..:|.:|:..:|.||.|||||.|||:|||.|||
  Fly   989 RILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPE 1053

Mouse   683 TIETLMKADIKIWILTGDKQETAINIGHSCRLLKRNMGMIVINEGSLDGTRETLSRHCTTL---- 743
            ||.:|:.|.|.:|:|||||.||||||.:|.:|..:.|.:|.:...|.|.....::.:.|.:    
  Fly  1054 TIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDMENDK 1118

Mouse   744 -------GDALRKENDFALIIDGKTLKYALTFGVRQY--FLDLALSCKAVICCRVSPLQKSEVVE 799
                   |.:|||:.. ||::|||||.:.|....:..  ||.|:..|.:|:|||.:||||:.:|:
  Fly  1119 TTSTLGYGQSLRKKQR-ALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVK 1182

Mouse   800 MVKKQVKVITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMVHGAWN 864
            :||:::.:.|||||||||||||||.|.|||||||.||:||..::|:::.:|:||:.||:.||.|.
  Fly  1183 VVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWC 1247

Mouse   865 YNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCR 929
            |:|:|:.|||.||||.....:..|:....|||||::.::..:.|||::||::|||.:|::::...
  Fly  1248 YDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVA 1312

Mouse   930 KENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTV----FGNGKTSDY 990
            ::.:||.|.|||..:..:.:....||:..|:.|:.|:::|:..|.|.....|    ||...|:. 
  Fly  1313 EDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDVGIWEFGTTITAS- 1376

Mouse   991 LLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVF-----------FGIYSSLWPA 1044
            .|..|.|:          ..:|...||....::|..|:..:.:|           ||:.||.|..
  Fly  1377 CLFANLVH----------CAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVI 1431

Mouse  1045 VPMAPDMSGEAAMLFSSGVFWVGLLSIPVASLLLDVLYKVIK 1086
            .           :.|:|.|.|:.::...|.::|..:|...::
  Fly  1432 F-----------VCFASAVHWLVIMLSTVVAVLPRLLLTTVR 1462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8a1XP_017176112.1 None
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 21/50 (42%)
ATPase-Plipid 250..1473 CDD:273734 388/1257 (31%)
E1-E2_ATPase 302..>394 CDD:278548 36/92 (39%)
Cation_ATPase <880..965 CDD:289987 36/85 (42%)
HAD_like <1177..1240 CDD:304363 36/63 (57%)
PhoLip_ATPase_C 1223..1468 CDD:292829 73/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.