DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ranbp16 and xpo-7

DIOPT Version :10

Sequence 1:NP_001188596.1 Gene:Ranbp16 / 118436 FlyBaseID:FBgn0053180 Length:1110 Species:Drosophila melanogaster
Sequence 2:NP_505698.2 Gene:xpo-7 / 179467 WormBaseID:WBGene00007952 Length:1096 Species:Caenorhabditis elegans


Alignment Length:64 Identity:15/64 - (23%)
Similarity:25/64 - (39%) Gaps:5/64 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WNEIPTIEQKILEALKGIKTR----NIRETNVVLFKKNEEIHVR-IELKPMEFPDTNRCKAVQA 74
            |....|:....||.|...:|.    |..:...:.|......::: |:..|.|:|..|....|:|
 Worm   204 WKWSRTVSSATLERLIIQRTEFTYFNGSDFKSITFDTPSLTYLKYIDFVPEEYPVVNLDSIVEA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ranbp16NP_001188596.1 IBN_N 25..87 CDD:197981 13/55 (24%)
xpo-7NP_505698.2 IBN_N 26..91 CDD:197981
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.