DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ap3s2 and or

Sequence 1:NP_033812.3 Gene:Ap3s2 MGIID:1337060 Length:193 Species:Mus musculus
Sequence 2:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster

Alignment Length:193 Identity:147/194 (76%)
Similarity:169/194 (87%) Gaps:7/194 (4%)


Mouse     1 MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIY 65
            ||:|||||||||||||.:|||.|.|.:||||::|||.||.|||||:|||||||||||||||||||
  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

Mouse    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||.|:|||||||
  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130

Mouse   131 ETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV 193
            :||||:|:|:||.||::.|.|.|:||||||||||||::|:|:     .|.|  ||:|:|.|.:
  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQ-----QIKD--IKLPDLPQAI 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ap3s2NP_033812.3 AP3_sigma 1..146 CDD:341438 123/145 (85%)
orNP_536793.1 APS2 1..143 CDD:227363 121/142 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75248697
eggNOG 1 0.900 E1_COG5030
Hieranoid 1 1.000
Homologene 1 1.000 H100592
Inparanoid 1 1.050 297 1.000 Inparanoid score I2693
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 1 1.000 T617088
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 LDO PTHR11753
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.