DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AP3S1 and or

Sequence 1:XP_016864514.1 Gene:AP3S1 HGNCID:2013 Length:238 Species:Homo sapiens
Sequence 2:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster

Alignment Length:158 Identity:105/159 (66%)
Similarity:119/159 (75%) Gaps:24/159 (15%)


Human   101 MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIY 165
            ||||||:||||||||||||||.:.|..|||||:|||.||||||:|||||||||.||||||.||||
  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

Human   166 RHYATLYFVFCVDSSESELGILDLIQ------------------------VHNILAEMVMGGMVL 206
            ||||||||||||||||||||||||||                        ||:||:|:|||||||
  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130

Human   207 ETNMNEIVTQIDAQNKLEKSETFIFQSP 234
            :||||:|:.:|:.|||:.|.|..|..:|
  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAP 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AP3S1XP_016864514.1 None
orNP_536793.1 APS2 1..143 CDD:227363 98/142 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75244389
eggNOG 1 0.900 E1_COG5030
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I2689
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 1 1.000 T610286
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 O PTHR11753
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.