DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and arhgap32b

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_009293685.1 Gene:arhgap32b / 569434 ZFINID:ZDB-GENE-091204-147 Length:1956 Species:Danio rerio


Alignment Length:164 Identity:46/164 - (28%)
Similarity:75/164 - (45%) Gaps:14/164 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GC-LSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGN- 209
            || |.::.......||.::..|...||..|: .:|:||:|......::||.: ...:..|.|.. 
Zfish   410 GCDLGEHLLNSGHDVPQVLKSCTEFIEKHGV-VDGMYRLSGIASNIQKLRHE-FDSEQIPDLTKD 472

  Fly   210 ---KDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEE---ATRHEDRLAVEMAVYLAVLELHQAHRD 268
               :|.|.:....|.:.|:|.:||:.......|.|   |...|:||   :.::..:.:|...|..
Zfish   473 VYIQDIHCVGSLCKLYFRELPNPLLTYQLYEKFSEAVSAATDEERL---IKIHDVIQQLPPPHYR 534

  Fly   269 TLAYLMLHWQKIAE-SPAVRMTVNNLAVIFAPTL 301
            ||.:||.|...:|. |....|...|||:::||.|
Zfish   535 TLEFLMRHLSHLATFSYVTNMHTKNLAIVWAPNL 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556
RhoGAP_MgcRacGAP 142..330 CDD:239847 46/164 (28%)
arhgap32bXP_009293685.1 PX_domain 124..238 CDD:295365
SH3_ARHGAP32_33 260..313 CDD:212769
RhoGAP_CdGAP 407..601 CDD:239849 46/164 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.