DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and cyk-4

DIOPT Version :8

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_499845.1 Gene:cyk-4 / 176815 WormBaseID:WBGene00000875 Length:681 Species:Caenorhabditis elegans

Alignment Length:278 Identity:90/279 (32%)
Similarity:131/279 (47%) Gaps:34/279 (12%)


  Fly    84 LREHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQPQI------ 142
            :|.|.| |::....:..|..|...::.| .|::||.|....|..||.:|.:.|||:|:.      
 Worm   349 MRPHTF-IEAGIKAMRKCDKCATALKLA-TSMKCRDCHQVVHRSCCNKLHLPCIPRPKTMMTPKS 411

  Fly   143 ---GTKRGC----LSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLR 200
               |.|.|.    |.|:.....||:||.::|||..:|||||.|||:|||.........|..: ||
 Worm   412 ALRGAKPGAGEFRLQDFCTSAKPMIPAAVIHCVVALEARGLTQEGIYRVPGQVRTVNVLLDE-LR 475

  Fly   201 GKSTPHLGNKDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATR------HEDRLAVEMAVYLAV 259
            .|:.|::|..|...:...:|.|||.|..||||...|::...|..      ...|||:..    .:
 Worm   476 SKTVPNVGLHDVEVITDTLKRFLRDLKDPLIPRTSRQELIVAANLYSTDPDNGRLALNR----VI 536

  Fly   260 LELHQAHRDTLAYLMLHWQK-IAESPAVRMTVNNLAVIFAPTLFG-------DLDLTLENVVTWQ 316
            .||.||:|||||||.:||:| ||:|...:|....:|.:.||.:.|       ...:...:.....
 Worm   537 CELPQANRDTLAYLFIHWRKVIAQSSRNKMNCEAMARMVAPAVMGHPVKQSQSQAIAGRDATDCH 601

  Fly   317 RVLKVLLLMPAGFWSQFL 334
            |.:..|......:|.:||
 Worm   602 RAMTALFEFDDVYWQRFL 619

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 17/52 (33%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 68/215 (32%)
cyk-4NP_499845.1 DUF5098 33..>184 CDD:293628
C1 352..402 CDD:294036 17/52 (33%)
RhoGAP_MgcRacGAP 418..615 CDD:239847 66/202 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C271476999
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.928771 Normalized mean entropy S4674
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002744
OrthoInspector 1 1.000 T374734
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46199
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4412
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.