DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr23a

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:356 Identity:72/356 - (20%)
Similarity:123/356 - (34%) Gaps:111/356 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 YTTGMLAVFSCVVIHFLNFW---------------GSTRVQDLANELLVLEYQQFASLNETKCPK 136
            |...:.....|.:.|.|.|:               |....||..:|.:..|..            
  Fly    58 YAQTIDCTLDCSLRHILTFFQTVSHAFIVVTSFLDGFRIKQDQLDEPIAFEDS------------ 110

  Fly   137 FNSFVIQKWL--SVIGLLLSYLSIAY----GLPGNNFSVEMVLINSLVQF--------SFNCNIM 187
                  ..||  :|:.:|:..|.:.|    ..|...|.:.:..:.:|..|        ||...:|
  Fly   111 ------DPWLAFTVLAMLVPTLGVEYLVCSNAPEYAFRIRIYHLKTLPSFLALQVQIISFILEVM 169

  Fly   188 HYYIGV-------LLIYRYL---W-------LINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRL 235
            ...|.|       |::.|.|   |       ..:.|....|.:||          |:|..|:...
  Fly   170 KVNIRVRQTKLQLLILARELSCRWPQRKQKPQFSDQQAHRVKDLK----------RRYNDLHYLF 224

  Fly   236 LELKGYMVATYEYHMTLVLTTGLASNFLAIYS---WIVLDISMNINFIYLLIFPLFLLVNVWNLW 297
            :.:.||...:.   :|:::.     :|....|   |:.:||......||.::..|..   ::|:.
  Fly   225 VRINGYFGGSL---LTIIIV-----HFAIFVSNSYWLFVDIRTRPWRIYAILLNLGF---IFNVA 278

  Fly   298 LSIAAS----DLAENAGKSTQTVL---------KLFADLEVKDIELERSVNEFALLCGHCQFNFH 349
            |.:||:    ..:.|.|:....::         ||:.||          |:||:|...|.:|...
  Fly   279 LQMAAACWHCQQSYNLGRQIGCLISKLVKPQGSKLYNDL----------VSEFSLQTLHQRFVVT 333

  Fly   350 VCGLFTINYKMGFQMIITSFLYLIYMIQFDF 380
            ....|::|..:...|......||:.:|||.|
  Fly   334 AKDFFSLNLHLLSSMFAAVVTYLVILIQFMF 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 72/356 (20%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 52/251 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.