DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and Gr23a

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster

Alignment Length:359 Identity:74/360 (21%)
Similarity:119/360 (33%) Gaps:117/360 (33%)


  Fly    87 YTTGMLAVFSCVVIHFLNFW---------------GSTRVQDLANELLVLEYQQFASLNETKCPK 136
            |...:.....|.:.|.|.|:               |....||..:|.:..|..            
  Fly    58 YAQTIDCTLDCSLRHILTFFQTVSHAFIVVTSFLDGFRIKQDQLDEPIAFEDS------------ 110

  Fly   137 FNSFVIQKWL--SVIGLLLSYLSIAY----GLPGNNFSVEMVLINSLVQF--------SFNCNIM 187
                  ..||  :|:.:|:..|.:.|    ..|...|.:.:..:.:|..|        ||...:|
  Fly   111 ------DPWLAFTVLAMLVPTLGVEYLVCSNAPEYAFRIRIYHLKTLPSFLALQVQIISFILEVM 169

  Fly   188 HYYIGV-------LLIYRYL---W-------LINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRL 235
            ...|.|       |::.|.|   |       ..:.|....|.:||          |:|..|:...
  Fly   170 KVNIRVRQTKLQLLILARELSCRWPQRKQKPQFSDQQAHRVKDLK----------RRYNDLHYLF 224

  Fly   236 LELKGYMVATYEYHMTLVLTTGLASNFLAIYS---WIVLDISMNINFIYLLIFPLFLLVNV---- 293
            :.:.||...:.   :|:::.     :|....|   |:.:||......||.::..|..:.||    
  Fly   225 VRINGYFGGSL---LTIIIV-----HFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFIFNVALQM 281

  Fly   294 ----------WNLWLSIAA--SDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQF 346
                      :||...|..  |.|.:..|.      ||:.||          |:||:|...|.:|
  Fly   282 AAACWHCQQSYNLGRQIGCLISKLVKPQGS------KLYNDL----------VSEFSLQTLHQRF 330

  Fly   347 NFHVCGLFTINYKMGFQMIITSFLYLIYMIQFDF 380
            .......|::|..:...|......||:.:|||.|
  Fly   331 VVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMF 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 74/360 (21%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 55/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.