DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and Gr8a

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster

Alignment Length:292 Identity:70/293 (24%)
Similarity:106/293 (36%) Gaps:92/293 (31%)


  Fly    12 LCW-----IILKATLYSSWFLG-VFPYR---FDSRNGQLKRSRFLLFYGL--------------- 52
            :.|     |.|.|.:.:..|.| .|.||   |...|..||    .:|..|               
  Fly    40 MAWSLFLLISLSALVLACLFSGEEFLYRGDMFGCANDALK----YVFAELGVLAIYLETLSSQRH 100

  Fly    53 ILNFFLL-LKMVCSGGQKLGIP------EAFARNSVLENTHYTTGMLAV----------FSCVVI 100
            :.||:.| .|:   ||||.|:.      :.|.|..:     :...|:|.          |..:..
  Fly   101 LANFWWLHFKL---GGQKTGLVSLRSEFQQFCRYLI-----FLYAMMAAEVAIHLGLWQFQALTQ 157

  Fly   101 HFLNFWGS-----------------------TRVQDLANEL-LVLEYQQFASLNETKCPKFNSF- 140
            |.|.||.:                       .::..|..|: |:.||.:|||......|.|.|| 
  Fly   158 HMLLFWSTYEPLVWLTYLRNLQFVLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFL 222

  Fly   141 ---VIQK---WLSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIYRY 199
               ::||   :..|..:|..:.. |:     |||:..||:...::.:.:|..|:|.|...:|...
  Fly   223 RRRLVQKQRIYSHVYDMLKCFQG-AF-----NFSILAVLLTINIRIAVDCYFMYYSIYNNVINND 281

  Fly   200 LWLINGQLLEMVTNL--KLDCSVDSSRIRKYL 229
            .:||...|||:...:  ...|.|...||...|
  Fly   282 YYLIVPALLEIPAFIYASQSCMVVVPRIAHQL 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 68/283 (24%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 70/293 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.