DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and Gr2a

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster

Alignment Length:435 Identity:93/436 (21%)
Similarity:157/436 (36%) Gaps:124/436 (28%)


  Fly    29 VFPYRF----DSRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEAFARNSVLENTHYTT 89
            ::|:|.    ||....|:|||:|..||..:........|....|:..:.|.....|.:.:..:| 
  Fly    19 LWPWRLAPPPDSEGILLRRSRWLELYGWTVLIAATSFTVYGLFQESSVEEKQDSESTISSIGHT- 82

  Fly    90 GMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQ-----FASLNETKCPKFNSFVIQKWLS-- 147
                      :.|:...| .||..||..|..|..:|     ||.|.|          |.:.||  
  Fly    83 ----------VDFIQLVG-MRVAHLAALLEALWQRQAQRGFFAELGE----------IDRLLSKA 126

  Fly   148 ----VIGLLLSY--------LSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLI---- 196
                |..:.::.        :.|.:|     ::|..:||......|.......|:|..||.    
  Fly   127 LRVDVEAMRINMRRQTSRRAVWILWG-----YAVSQLLILGAKLLSRGDRFPIYWISYLLPLLVC 186

  Fly   197 -YRYLWLINGQ---------LLEMVTNLKL---DCSVDS-------------SRIRKYLSLYRRL 235
             .||..:.|..         ||..:..|:|   ..:||:             .|:.....:|:|:
  Fly   187 GLRYFQIFNATQLVRQRLDVLLVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQRV 251

  Fly   236 LELKGYMVATYE--YHMTLVLTTGLASNFLAIYS---WIVLDISMNINFIYLLIFPLFLL----V 291
            ..|    ||...  |.:::::..|  ::||||.|   |      |.:||......|..:|    .
  Fly   252 WAL----VALLNRCYGLSMLMQVG--NDFLAITSNCYW------MFLNFRQSAASPFDILQIVAS 304

  Fly   292 NVWN-------LWLSIAASDLAENAGKSTQTVLKLFADLEVKD----------------IELERS 333
            .||:       |.||:.....|:.|.:....:.::..||..:.                |.:...
  Fly   305 GVWSAPHLGNVLVLSLLCDRTAQCASRLALCLHQVSVDLRNESHNALVGTLVRYCAPLIILVPLQ 369

  Fly   334 VNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQF 378
            :.:|:|...|.:.:|...|.|.::..:.:.::..:..|||.:|||
  Fly   370 ITQFSLQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQF 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 93/436 (21%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 93/436 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4688493
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.