DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and lite-1

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans

Alignment Length:440 Identity:92/441 (21%)
Similarity:164/441 (37%) Gaps:114/441 (26%)


  Fly     8 LQSRLCWIILKATLYSSWF----LGVFPYRFDSRNGQLKRSRFLLF--YG----LILNFFLLLKM 62
            |.||..|.|...|||..::    ||:        |..::.:..|||  |.    .:|.|..|.|.
 Worm    35 LSSRNKWAICDRTLYPIYYLLLILGL--------NQSIRPNNSLLFRIYSWLVFCLLLFTTLRKF 91

  Fly    63 ----VCSGGQKLGIPEAFAR--------NSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLA 115
                |...|.:..:.|.||.        |:::    ..:|:||......:      |:.|::.| 
 Worm    92 NQVGVRPNGTRENLQEFFANPRSMITLCNALI----MLSGLLASLQLYTL------GAKRLKPL- 145

  Fly   116 NELLVLEYQQFASLN-ETKCPKFNSFVIQKWLSVIGLLLS-------------YLSIAYGLPGNN 166
             ::|.    || ||| .||..:...|:|..:|:|...||:             |:....|.|  |
 Worm   146 -KILC----QF-SLNVRTKQAERRQFMINTFLAVFSGLLALTMAATYAMSKWGYILYIVGTP--N 202

  Fly   167 FSVE---MVLINSLVQFSFNCNIMHYYIGVLLIYRYLWLINGQLL----EMVTNLKLDCSVDSSR 224
            ...|   .||::|...|.....|...   .:|.|::..:|...:.    |||...:.:|.:..|.
 Worm   203 LDTETIFCVLLDSYALFVSRAAISAL---AILFYQHCSVIRRSIKHLINEMVPAEQDECPLPESS 264

  Fly   225 IRKYLSL---YRRLLELKGYM------VATYEYHMTL-----VLTTGLA------SNFLAIYSWI 269
            ::|....   |:|:...|..:      |..|.|.:.:     ::..|::      |..::|..||
 Worm   265 LQKIHDCQISYQRIFNGKAVIEEYYSFVLFYSYGVCIPIFCFLMFVGMSAQSICWSEVVSIVIWI 329

  Fly   270 VLDISMNINFIYLLIFPLFLLVNVWNLWLSIAASDLAENAGKSTQTVLKLFADL--EVKDIELER 332
            |..|      :.||:|             |:.|..:.|:..:...:..:::.:.  |.:|:.:..
 Worm   330 VNAI------LVLLLF-------------SLPAFMINEDGDRLVASSFRMYHETFHEERDLTVLS 375

  Fly   333 SVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFDFMN 382
            .:..|.......:.....|..|.::..:...:......|.:.:.:||..|
 Worm   376 QMTFFTFQIHSTKLTLSACNYFYMDRSILLSLFSAILTYFLILWEFDIKN 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 86/430 (20%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 77/391 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4688579
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.