DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and Gr22d

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster

Alignment Length:389 Identity:145/390 (37%)
Similarity:242/390 (62%) Gaps:8/390 (2%)


  Fly     1 MFASRSDLQSRLCWIILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMVCS 65
            ||..|..|:.:..::|||:.|||||.||:||::::.:..:|:||.:|:.:|::::..||:.||..
  Fly     1 MFRPRCGLRQKFVYVILKSILYSSWLLGIFPFKYEPKKRRLRRSMWLILFGVVISSSLLILMVKQ 65

  Fly    66 GGQ--KLGIP-EAFARNSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFA 127
            ..:  :.||. :.|.||::|.......|::.|.|...:|....|.|..::::.|.|::||.:.|.
  Fly    66 SAEDREHGIMLDVFQRNALLYQISSLMGVVGVVSICTVHLRTLWRSKHLEEIYNGLMLLEAKYFC 130

  Fly   128 SLNETKCPKFNSFVIQKW-LSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYI 191
            | |..:||.|:.:||||. :.|:|||..:: :.:|:|.:...|..||:.|:|:.......:||::
  Fly   131 S-NAVECPAFDGYVIQKGVVIVVGLLAPWM-VHFGMPDSKLPVLNVLVVSMVKLGTLLLALHYHL 193

  Fly   192 GVLLIYRYLWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLELKGYMVATYEYHMTLVLTT 256
            ||::|||::||||.:||.:|.:|:.:....|||:|..|.||.:|:.|...:...|:....|::..
  Fly   194 GVVIIYRFVWLINRELLSLVCSLRGNHKGSSSRVRFLLKLYNKLVNLYSKLADCYDCQTVLMMAI 258

  Fly   257 GLASNFLAIYSWIVLDISMN--INFIYLLIFPLFLLVNVWNLWLSIAASDLAENAGKSTQTVLKL 319
            .||:|.:..:..||..||::  ..|:.|::|||.:..|..:.|||:...||.:..|:.|..:|||
  Fly   259 FLAANIIVCFYMIVYRISLSKMSFFVMLIMFPLAIANNFMDFWLSMKVCDLLQKTGRQTSMILKL 323

  Fly   320 FADLEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFDFMNL 383
            |.|:|..|.:||.|:::|||.|.|.:|.|..||||.:|.:|||:|.:.|.|||:|::|||:|||
  Fly   324 FNDIENMDKDLEISISDFALYCSHRRFKFLHCGLFHVNREMGFKMFVASVLYLLYLVQFDYMNL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 138/371 (37%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 138/371 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BXVD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.