DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22c and Gr36a

DIOPT Version :9

Sequence 1:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:432 Identity:80/432 - (18%)
Similarity:160/432 - (37%) Gaps:114/432 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WI--ILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEAF 76
            |:  :||...|....:|:..:..|.:.|::..::..:.:.:.:|..:.:.::....:|..:...|
  Fly     4 WVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNLDVYF 68

  Fly    77 ARNS--------VLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETK 133
            .|.:        |:.:....:|:.|:        ||.|     :..|..:.::|......|.:..
  Fly    69 GRANQLHQYVIIVMVSLRMASGISAI--------LNRW-----RQRAQLMRLVECVLRLFLKKPH 120

  Fly   134 CPKFNSFVIQKWLSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFS--------FNCNIMHYY 190
            ..:.:.:.|....|| |::.::|.:|..:.    |::.:..|..|..:        .|..|..:|
  Fly   121 VKQMSRWAILVKFSV-GVVSNFLQMAISME----SLDRLGFNEFVGMASDFWMSAIINMAISQHY 180

  Fly   191 IGVLLIYRYLWLINGQLLEMVTNLKL-------------DCSVDSSRIRKYLSLYRRL------- 235
            :.:|.:..|..|:..::.:.:...::             .|...:.||.....|..:|       
  Fly   181 LVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQSIVTQL 245

  Fly   236 ---LELKGYMVATY-EYHMTLVLTTGLASNFLAIYSWIVLDISMN-INFIYL------LIFPLFL 289
               ..::|.||  | .|::..|.||           :|...:::| |..::|      |:|..||
  Fly   246 NQVFGIQGIMV--YGGYYIFSVATT-----------YITYSLAINGIEELHLSVRAAALVFSWFL 297

  Fly   290 LV---NVWNLWLSIAASDLAENAGKSTQTVLKLFAD-------LEVK-------DIELERSVNEF 337
            ..   .:.||::                 :||||.|       ||.:       |:.||:|....
  Fly   298 FYYTSAILNLFV-----------------MLKLFDDHKEMERILEERTLFTSALDVRLEQSFESI 345

  Fly   338 ALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFD 379
            .|..........|..:|||.......||.:.....|::||:|
  Fly   346 QLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQYD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 79/427 (19%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 79/427 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.