DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and Gr59b

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster

Alignment Length:404 Identity:81/405 (20%)
Similarity:142/405 (35%) Gaps:86/405 (21%)


  Fly    14 WIILKATLYSSWFLGVFPYRFDSRNGQLKRSRFLLFYGLILNFFLLL---------KMVCSGGQK 69
            |:| |.....|..:|:...:|.:|  :...:.|...|.||.|...|:         ::|..  ||
  Fly     4 WMI-KLYFRYSLAIGITSQQFSNR--KFFSTLFSRTYALIANIVTLIMLPIVMWQVQLVFQ--QK 63

  Fly    70 LGIPE-AFARNSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASLNETK 133
            ...|: ....|:|.|...:...:..|.|       ..:..|..:::...||.|..:      |.:
  Fly    64 KTFPKLILITNNVREAVSFLVILYTVLS-------RGFRDTAFKEMQPLLLTLFRE------EKR 115

  Fly   134 CP--------------KFNSFVIQKWLSVIGLLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNC 184
            |.              .|..|....||.|..:|...           :|.:.::..::::|.|.|
  Fly   116 CGFKGIGGVRRSLRILLFVKFFTLSWLCVTDVLFLL-----------YSTDALIWVNVLRFFFKC 169

  Fly   185 NI--------MHYYIGVLLIYRYLWLINGQLLEMVTNLKLDCSVDSSRIRKYLSLYRRLLELKGY 241
            |.        |.|::.       ||.| .:..:.| |.:||..|.|...||:..| :.|..|...
  Fly   170 NTNNILEMVPMGYFLA-------LWHI-ARGFDCV-NRRLDQIVKSKSTRKHREL-QHLWLLHAC 224

  Fly   242 MVATYEYHMTLVLTTGLASNF-------LAIYSWIVLDISMNINFIYLLIFPLFLLVNVWNLWLS 299
            :..|......:.....|||.|       :..|...|....::..|.:::...:...|...:.:|.
  Fly   225 LTKTALNINKIYAPQMLASRFDNFVNGVIQAYWGAVFTFDLSTPFFWVVYGSVQYHVRCLDYYLI 289

  Fly   300 IAASDLAENAGKSTQTVLKLFADLEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQM 364
            ....|:|.....|        |.....::...:.::.:.:.....:.....||||..|..|.|.|
  Fly   290 DNMCDVAVEYHDS--------AKHSWSEVRWTKEISSYVIYANSTKLQLWSCGLFQANRSMWFAM 346

  Fly   365 IITSFLYLIYMIQF 378
            |.:...|::.::||
  Fly   347 ISSVLYYILVLLQF 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 79/402 (20%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 80/403 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.