DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and Gr28a

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster

Alignment Length:431 Identity:89/432 (21%)
Similarity:170/432 (39%) Gaps:107/432 (25%)


  Fly    27 LGVFPYRFD-SRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEA------FARNSVL-- 82
            ||:.|:|.: :...:::.|:|..|.|::...|.:|   |.|   :.:.|.      |.:.::.  
  Fly    28 LGLAPFRLNLNPRKEVQTSKFSFFAGIVHFLFFVL---CFG---ISVKEGDSIIGYFFQTNITRF 86

  Fly    83 -ENTHYTTGMLAVFSCVVIHFLNFWGSTRVQDLANELLV----------LEYQQFASLNETKCPK 136
             :.|...||:||:  ..:..|..|.....|..:.|.::|          |:|::..         
  Fly    87 SDGTLRLTGILAM--STIFGFAMFKRQRLVSIIQNNIVVDEIFVRLGMKLDYRRIL--------- 140

  Fly   137 FNSFVIQKWLSVIGLLL---SYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIYR 198
            .:||:|.     :|:||   .||.::|.|     .|...:..|.|.|: ...:.|..|. |::::
  Fly   141 LSSFLIS-----LGMLLFNVIYLCVSYSL-----LVSATISPSFVTFT-TFALPHINIS-LMVFK 193

  Fly   199 YLW----------LINGQL-------LEMVTNLKLDCSVDSSRIRKYLSLYRRLLE--LKGYMVA 244
            :|.          ::|..|       :|.::.|:|.........|:|....|.|:.  :|.|.|.
  Fly   194 FLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLISTPMKRYSVT 258

  Fly   245 TY-----EYHMTLV-----LTTGLASNFLAIYSWIVLDISMNINFIYLLIFPLFLLVNVWN---- 295
            :.     ||.:..|     |...:.......:::.:|.| :.|:|:::|....::|..:.|    
  Fly   259 SVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGI-IAISFLFILFDDFYILEAILNPKRL 322

  Fly   296 ----------------LWLSIAASDLAENAGK----STQTVLKLFADLEV-KDIELERSVNEFAL 339
                            :|..:....:.|.:.:    |:.|...:...|.: .|.||...:...:|
  Fly   323 DVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIVHKILNITDDPELRDRLFRLSL 387

  Fly   340 LCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFDF 380
            ...|.:..|...|||.::..:.|.:...:..|||.:|||.|
  Fly   388 QLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRF 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 89/432 (21%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 89/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4688480
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.