DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr22c and Gr98c

Sequence 1:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster

Alignment Length:399 Identity:93/400 (23%)
Similarity:154/400 (39%) Gaps:81/400 (20%)


  Fly    31 PYRFDSRNGQLKRSRFLLFYGLILNFFLLLKMVCSGGQKLGIPEAFARNSV----------LENT 85
            |..|.:|..: ||.||....|..|....:|.||.         ..|..|.|          :|:.
  Fly    29 PAEFFTRTLR-KRRRFCWMAGYSLYLIAILLMVF---------YEFHANIVSLHLEIYKFHVEDF 83

  Fly    86 HYTTG------MLAVFSCVVIHFLNFWGSTRVQDLANELLVLEYQQFASL-------NETKCPKF 137
            ....|      ::|:.:|..::.|..:|.          |.|.|.:.|:|       ::..|.|.
  Fly    84 SKVMGRTQKFLIVAIATCNQLNILLNYGR----------LGLIYDEIANLDLGIDKSSKNFCGKS 138

  Fly   138 N--SFVIQKWLSVIGLLLSYL-----SIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLL 195
            :  ||.::..|| |||.:..:     .:..|..|..|.....::..::..........|.:.|||
  Fly   139 HWWSFRLRLTLS-IGLWMVIIIGVIPRLTLGRAGPFFHWVNQVLTQIILIMLQLKGPEYCLFVLL 202

  Fly   196 IYRYLWLINGQLLEMVTNLK-LDCSVDSSRIRKYL-------SLYRRLLELKGYMVATYEYHMTL 252
            :|..:......|.::..:|: .||   .:||::..       .|..|:..|...:.|.:.:.|||
  Fly   203 VYELILRTRHVLEQLKDDLEDFDC---GARIQELCVTLKQNQLLIGRIWRLVDEIGAYFRWSMTL 264

  Fly   253 V-LTTGLASNFLAIYSW-IVLDISMN----INFIYLLIFPLFLLVNVWNLWLSIAASDLAENAGK 311
            : |..||  ..|.:.:| |:..|..|    :|.:..:.|..|      ||.|:...|:.......
  Fly   265 LFLYNGL--TILHVVNWAIIRSIDPNDCCQLNRLGSITFLSF------NLLLTCFFSECCVKTYN 321

  Fly   312 STQTVLKLFADLEVKD--IELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIY 374
            |...:|.....|...:  ..|:..:.|:.|...|.:..|...|||.||.|:...|::|...|:|.
  Fly   322 SISYILHQIGCLPTAEEFQMLKMGLKEYILQMQHLKLLFTCGGLFDINIKLFGGMLVTLCGYVII 386

  Fly   375 MIQF---DF 380
            ::||   ||
  Fly   387 IVQFKIQDF 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 93/400 (23%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 91/396 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.